KEGG   Blastochloris sp. GI: BLTE_19480Help
Entry
BLTE_19480        CDS       T05837                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
blag  Blastochloris sp. GI
Pathway
blag00071  Fatty acid degradation
blag00072  Synthesis and degradation of ketone bodies
blag00280  Valine, leucine and isoleucine degradation
blag00310  Lysine degradation
blag00362  Benzoate degradation
blag00380  Tryptophan metabolism
blag00620  Pyruvate metabolism
blag00630  Glyoxylate and dicarboxylate metabolism
blag00640  Propanoate metabolism
blag00650  Butanoate metabolism
blag00900  Terpenoid backbone biosynthesis
blag01100  Metabolic pathways
blag01110  Biosynthesis of secondary metabolites
blag01120  Microbial metabolism in diverse environments
blag01130  Biosynthesis of antibiotics
blag01200  Carbon metabolism
blag01212  Fatty acid metabolism
blag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:blag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLTE_19480
   00630 Glyoxylate and dicarboxylate metabolism
    BLTE_19480
   00640 Propanoate metabolism
    BLTE_19480
   00650 Butanoate metabolism
    BLTE_19480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BLTE_19480
   00072 Synthesis and degradation of ketone bodies
    BLTE_19480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BLTE_19480
   00310 Lysine degradation
    BLTE_19480
   00380 Tryptophan metabolism
    BLTE_19480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BLTE_19480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BLTE_19480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BLTE_19480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blag04147]
    BLTE_19480
Enzymes [BR:blag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BLTE_19480
Exosome [BR:blag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLTE_19480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BBF93263
UniProt: A0A348G130
Position
complement(2098788..2099912)
Genome map
AA seq 374 aa AA seqDB search
MSAVIVAARRTAVAPRGGAFAQIEPHDLARRVIAAVLADAGLAPDAVEDVILGNALYGGG
NPARRAALAAGIPETVPALTLDSQCCAGLDAILLAAERVEAGAADVIVAGGVESFSRAPI
RQHRPRGPGEVPVAYDRPPFTPWPERDPDMIPAAAALAAELGFPRAAQEAFAVESHRKAL
AGSAAGEIVAVADLGRDAFTRALTPAAAARLKPLAGEGAHAVTVATVAVEADAAAAVLVA
SECRLGAFRLPGRPLRILAGARCGGDPVRPGLAPIAAARAALERAGRRVGDLATAEIMEA
FAVQAMACIDGIGLDAGIVNRSGGALARGHPIGASGAILAVRLWHELQRERPGATGLAAI
AAAGGLGSALVADV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgtcatcgtcgccgcccgccgcaccgcggtcgccccgcgcggcggcgcgttc
gcgcaaatcgagccgcacgacctcgcgcgccgggtgatcgccgccgtgctggccgatgcc
gggctggcgccggacgcggtcgaagacgtcatcctcggcaacgccctctatggcggcggc
aatccggcgcgccgcgccgcactcgccgccggcatccccgagaccgtgccggcgctgacg
ctcgacagccaatgctgcgccgggctcgacgccatcctgctggccgccgagcgcgtcgaa
gcgggcgcggcggacgtgatcgtcgcggggggcgtcgagagcttcagccgggcgccgatc
cgccagcaccggccgcgcgggccgggcgaggtgccggtggcctatgaccgaccgcccttc
acgccctggcccgagcgcgaccccgacatgatcccggccgcggcagcgcttgcggccgaa
ctcggcttcccgcgcgcggcgcaggaggcgttcgcggtcgagagccaccgcaaggcgctt
gccggctcggcggccggcgagatcgtggcggtggcggatcttgggcgcgacgccttcacc
cgcgcgctgacgccggccgctgccgcccggctgaagccgctggcgggcgagggcgcccat
gccgtcacagtggccacagtcgcggtcgaggccgatgcggcggccgcggtgctggtggcg
agcgaatgccggctcggcgcgttcaggcttccgggccggccgctgcgtattttggccggg
gcgcggtgcggcggcgacccggtccggcccggcctcgcgccgatcgcggccgcccgcgcc
gcgctggagcgcgcgggtcgtagggtgggcgacctcgccacggccgagatcatggaggcg
ttcgcggtgcaggcgatggcctgcatcgacggcatcgggctcgatgcggggatcgtcaac
cgctccggcggcgcgctggcccgcggccacccgatcggcgcctccggtgcgattctcgcg
gtaaggctatggcacgagctgcagcgcgagcgccccggcgccaccggccttgccgccatc
gccgcggccggcggcctcggcagcgcgctggtggcggacgtgtag

DBGET integrated database retrieval system