KEGG   Blastomonas sp. RAC04: BSY18_1014Help
Entry
BSY18_1014        CDS       T04450                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00071  Fatty acid degradation
blas00072  Synthesis and degradation of ketone bodies
blas00280  Valine, leucine and isoleucine degradation
blas00310  Lysine degradation
blas00362  Benzoate degradation
blas00380  Tryptophan metabolism
blas00620  Pyruvate metabolism
blas00630  Glyoxylate and dicarboxylate metabolism
blas00640  Propanoate metabolism
blas00650  Butanoate metabolism
blas00900  Terpenoid backbone biosynthesis
blas01100  Metabolic pathways
blas01110  Biosynthesis of secondary metabolites
blas01120  Microbial metabolism in diverse environments
blas01130  Biosynthesis of antibiotics
blas01200  Carbon metabolism
blas01212  Fatty acid metabolism
blas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY18_1014
   00630 Glyoxylate and dicarboxylate metabolism
    BSY18_1014
   00640 Propanoate metabolism
    BSY18_1014
   00650 Butanoate metabolism
    BSY18_1014
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY18_1014
   00072 Synthesis and degradation of ketone bodies
    BSY18_1014
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY18_1014
   00310 Lysine degradation
    BSY18_1014
   00380 Tryptophan metabolism
    BSY18_1014
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY18_1014
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY18_1014
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY18_1014
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blas04147]
    BSY18_1014
Enzymes [BR:blas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY18_1014
Exosome [BR:blas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY18_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C YadA_head
Motif
Other DBs
NCBI-ProteinID: AOF99718
UniProt: A0A1B3N2Z8
Position
complement(1020113..1021285)
Genome map
AA seq 390 aa AA seqDB search
MSSIVITAAKRTPVGSFLGAYAATPAHELGRIAIEAALAQSGITGEDVSEVILGQVLTAG
QGQNPARQASINAGIPKEVPAYGVNQVCGSGLRAVALGFQSIANGDADIIVAGGQENMSM
SPHAQMLRAGQKMGDLKLVDTMVYDGLTDVFNQYHMGITAENLAEKYQITREAQDRFAVR
SQNLAEKARADGRFMDEIAPVTIKGRKGDVTVTDDEYIRAGATYESVAGLRPAFKKDGTV
TAANASGLNDGAAALVLMREEDAAKRGLAPLGRIASWASMGVDPSIMGIGPVSASRRALA
KAGWSVEDLDLIESNEAFAAQALSVTQEMGWDPEKVNVNGGAIAIGHPIGASGARVLTTL
LYEMARRDAKKGLATLCIGGGMGIAVCIER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcatcgtcatcaccgccgccaagcggacccccgtgggcagctttctgggcgcc
tatgccgcaacccccgcgcacgagctcggccgcatcgcgatcgaggcagcgcttgcgcag
tcgggaatcaccggcgaggacgtatcagaggtgatcctcggccaggtgctcaccgcaggc
cagggccagaacccggcccgccaggcttcgatcaacgctggcatacccaaggaggtgccc
gcctatggcgtcaaccaggtctgcggatcgggtctgcgcgcggtcgcgctgggcttccag
tcgatcgccaatggcgatgccgatatcatcgtcgcgggtggccaggaaaacatgtcgatg
tcgccgcacgcccagatgctgcgcgccggacagaagatgggcgacctcaagctcgtcgac
acgatggtgtatgatggcctgaccgatgtgttcaaccagtatcacatgggcatcaccgcc
gagaacctggccgagaagtaccagattacccgcgaggcgcaggaccgttttgccgtgcgc
tcgcagaaccttgccgaaaaggcgcgcgccgatggccgcttcatggatgagatcgcaccc
gttacgatcaagggccgcaagggtgatgtcacggtcaccgacgacgagtatatccgcgcc
ggcgcgacctatgaaagcgtcgcaggcctcaggcccgcgttcaagaaggacggcaccgtc
accgccgccaatgccagcggcctcaacgatggcgcggccgccctggtgctgatgcgcgag
gaagacgccgccaagcgcggacttgccccactgggccgcatcgccagctgggcctcgatg
ggcgtcgatccttcgatcatggggatcggcccggtatcggccagccgtcgcgcactcgcc
aaggcgggctggagcgtcgaggatctcgacctgatcgaatcgaacgaggcgttcgccgcg
caggcgctgtcggtgacgcaggaaatgggctgggaccccgagaaggtgaacgtcaacggc
ggcgcgatcgccatcggccatccgatcggcgccagcggtgcgcgggtgctcaccaccctg
ctctacgaaatggcgcgccgcgacgcgaaaaagggcctggcgactttgtgcatcggcggc
ggcatgggcatcgcggtctgcatcgagcgctga

DBGET integrated database retrieval system