KEGG   Blastomonas sp. RAC04: BSY18_1137Help
Entry
BSY18_1137        CDS       T04450                                 

Definition
(GenBank) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BSY18_1137
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:blas01002]
    BSY18_1137
Enzymes [BR:blas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     BSY18_1137
Peptidases [BR:blas01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   BSY18_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AOF99545
UniProt: A0A1B3N2H5
Position
complement(1141344..1142030)
Genome map
AA seq 228 aa AA seqDB search
MTQAKSPFNVVFVLFDNVTQLDFTGPAQFLCRMPEAKVHVAAASLDPVMTDVGFGIMPTV
TFEDCPQADLLCLPGGLGVAPALSDVALIAFVRAQASAAQWVTSVCTGAFILGRAGLLQG
RRATTHWGYTSLLPMVGALHEDARTVFDGNVVTAGGVTSGIDFALTIIAHLHGEDVARSL
QLNFEYDPAPPFAGGTPANSPPHIVQTMQTRFYDARSAEMEAALVATA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagcaaaatcacccttcaatgtcgtgttcgtcctgttcgacaatgtcacccag
ctcgatttcaccggccccgcgcagttcctgtgccggatgccggaggccaaggtgcatgtc
gcggcggcgagcctcgatccggtgatgacggatgtcgggttcggcatcatgcccacagtg
acgtttgaagattgtcctcaggccgatttgctgtgcttgccgggaggtctgggcgttgcg
cctgcgctcagcgatgttgcgctgatcgcgttcgtgcgggcacaggcatcggccgcgcaa
tgggtgaccagcgtatgcaccggcgcatttatccttggccgggcaggtttgctgcaggga
aggcgtgcaacaacccactggggctacaccagcctgctgccgatggtgggggccttgcat
gaagacgcgcgcaccgtgttcgacggcaacgtggtgacagcaggcggggtgacttcgggg
atcgactttgcgctgacgatcatcgcgcacctgcacggcgaggatgtcgcgcgttcgctg
cagctcaacttcgaatacgaccccgcgccgccctttgccgggggcacgcctgccaacagc
ccgccgcacatcgtgcagaccatgcagacccggttctacgacgcccgttcggccgagatg
gaggccgcgctcgtcgccaccgcgtaa

DBGET integrated database retrieval system