KEGG   Blastomonas sp. RAC04: BSY18_1809Help
Entry
BSY18_1809        CDS       T04450                                 

Definition
(GenBank) alkaline phosphatase family protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00730  Thiamine metabolism
blas00790  Folate biosynthesis
blas01100  Metabolic pathways
blas02020  Two-component system
Module
blas_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSY18_1809
   00790 Folate biosynthesis
    BSY18_1809
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY18_1809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blas04147]
    BSY18_1809
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:blas00537]
    BSY18_1809
Enzymes [BR:blas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BSY18_1809
Exosome [BR:blas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY18_1809
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:blas00537]
 Enzymes
  BSY18_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AOG00746
UniProt: A0A1B3N5X2
Position
complement(1904399..1905910)
Genome map
AA seq 503 aa AA seqDB search
MNRPLAALLCLAALWAEPGFAQHNAPEAVAPDKERGEQTAADYAAQGRAQLEARLAAPVN
QGKAKNLIIFIGDGMGVSTLTAARIWQGQKAGRDGESTETAIDAMPYSALIKTYSHDFQV
ADSAATASAIVTGIKTRSGMLSVTPVAQRGRCETASGQDVPTLFEQAGAAGKQLGLISTA
RITHATPASAYSHSVDRNWESNSELPAGATCHDIARQLVEWSQSSQLKLVLGGGRTAFYP
KDQSDPEYADKKGNRTDGRNLVAEWKKKHPKGQYIWNAAQFGALDANADAPVLGLFEPSH
MQFEADRASDKAGEPSLAEMTALAITRLGSADKGYVLMIEGGRIDHAHHGGNAHRALDDT
VAFEAAIARALEMVDLEDTLVLVTADHSHVFTIAGYPPRGTSIFGLASVTEDGEPVNAKD
GKPYTTLGYANGPGAKVAGPRNDPSQEDTEALNYQQQATVPTSGETHGGEDVVLKAAGPS
AHLFHGTLEQHSIYHIAKHILGF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtccgcttgccgccttgctgtgccttgccgctctttgggctgagccgggcttc
gcccagcacaacgcgcccgaggcggttgcgcccgacaaggagcgcggcgagcagaccgcc
gccgattacgccgcgcagggccgcgcgcagctcgaggcgcggctggcggcgccggtcaac
cagggcaaggcgaagaacctcatcatcttcataggcgatggcatgggggtcagcacgctg
acggctgcgcgcatctggcaggggcagaaggcaggccgcgatggcgaatcgaccgagacc
gcgatcgacgcgatgccctattcggcgctgatcaagacctacagccatgatttccaggtt
gccgattcggcggcgaccgcgtccgccatcgtcaccggcatcaagacccgttcaggcatg
ctctcggttaccccggttgcgcagcgcggcaggtgcgagaccgccagcgggcaggacgtg
ccgacgctgttcgagcaggcaggcgctgcgggcaagcagctggggctgatctccaccgcg
cgaatcacccacgcaacgcccgcgtccgcttattcgcacagcgtcgaccgcaactgggaa
agcaacagcgaactgcccgcaggcgcaacgtgtcacgacatcgcgcgccagctggtcgaa
tggtcgcagtcgagccagctcaagctggtgctgggcggtgggcgcacggcattctacccc
aaggaccagagcgatccggaatacgccgacaagaagggcaaccgcaccgatggtcgcaac
ctggtggcggagtggaagaagaaacatcccaagggccagtacatctggaacgcagcgcag
ttcggcgcgcttgatgccaacgccgatgcgccggtgctgggcctgttcgagcccagccac
atgcagttcgaggccgatcgtgccagcgacaaggcaggcgagccttcgctggccgagatg
accgcgctggcgatcacccggctgggctctgcggacaagggctatgtgctgatgatcgag
ggcggccgcatcgaccacgcgcatcacggcggcaacgcccaccgcgcgctcgatgatacc
gtcgcgttcgaggcggcgatcgccagggcgctcgagatggtcgatctcgaggacacattg
gtgctggtcaccgccgatcacagccatgtcttcaccatcgcgggctatccgccgcgcggc
acctcgatcttcgggcttgccagcgtcaccgaggatggcgagccggtcaacgccaaggat
ggcaagccttacaccacgctgggttacgccaatggccccggcgccaaggtcgctggcccg
cgcaacgatccttcgcaggaggacaccgaggcgctgaactatcagcagcaggccaccgtg
ccgacctcgggcgaaacgcatggcggggaggatgtcgtgctgaaagccgccggtcccagc
gcgcaccttttccacggcacgctggaacagcacagcatctatcacatcgcgaagcatatc
ctgggtttttaa

DBGET integrated database retrieval system