KEGG   Blastomonas sp. RAC04: BSY18_1914Help
Entry
BSY18_1914        CDS       T04450                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
blas  Blastomonas sp. RAC04
Pathway
blas03010  Ribosome
Brite
KEGG Orthology (KO) [BR:blas00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSY18_1914 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:blas03011]
    BSY18_1914 (rplV)
Ribosome [BR:blas03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSY18_1914 (rplV)
  Bacteria
    BSY18_1914 (rplV)
  Archaea
    BSY18_1914 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOF99840
UniProt: A0A1B3N3A3
Position
complement(2031368..2031745)
Genome map
AA seq 125 aa AA seqDB search
MGKAKSPRRVGDNEALAVGTTIRGSAQKLGLVAALIRGKKAEEAMNILAFSKKGMAVDAR
KVLASAIANAENNHNLDVDALVVAEASVGKAITMKRFMTRARGRSSRILKPFSRLRIVVR
EQEEA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcaaaatctccgcgtcgcgttggtgacaatgaggctctggctgtcggcacg
accatccgtggttctgcgcagaagctgggtctggttgctgccctgatccgtggcaagaag
gccgaagaggcgatgaacatcctggccttctcgaagaagggcatggcggtcgacgcacgc
aaggttctggcatctgcgattgcgaatgccgaaaacaaccacaatctcgatgttgacgcg
ctggtcgtggctgaagcgagtgttggcaaggcgatcacgatgaagcgtttcatgacgcgc
gctcgtggccgttccagccgcatcctgaagccgttcagccgcctgcgtatcgtcgtgcgc
gaacaagaggaagcgtaa

DBGET integrated database retrieval system