KEGG   Blastomonas sp. RAC04: BSY18_2327Help
Entry
BSY18_2327        CDS       T04450                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00280  Valine, leucine and isoleucine degradation
blas00310  Lysine degradation
blas00362  Benzoate degradation
blas00380  Tryptophan metabolism
blas00620  Pyruvate metabolism
blas00630  Glyoxylate and dicarboxylate metabolism
blas00640  Propanoate metabolism
blas00650  Butanoate metabolism
blas00900  Terpenoid backbone biosynthesis
blas01100  Metabolic pathways
blas01110  Biosynthesis of secondary metabolites
blas01120  Microbial metabolism in diverse environments
blas01130  Biosynthesis of antibiotics
blas01200  Carbon metabolism
blas01212  Fatty acid metabolism
blas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY18_2327
   00630 Glyoxylate and dicarboxylate metabolism
    BSY18_2327
   00640 Propanoate metabolism
    BSY18_2327
   00650 Butanoate metabolism
    BSY18_2327
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY18_2327
   00072 Synthesis and degradation of ketone bodies
    BSY18_2327
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY18_2327
   00310 Lysine degradation
    BSY18_2327
   00380 Tryptophan metabolism
    BSY18_2327
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY18_2327
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY18_2327
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY18_2327
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blas04147]
    BSY18_2327
Enzymes [BR:blas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY18_2327
Exosome [BR:blas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY18_2327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AOG02299
UniProt: A0A1B3NAC3
Position
2461318..2462862
Genome map
AA seq 514 aa AA seqDB search
MTLSPNTPVLIGVGQTVDHWDGSDPAAAPSPQGLMQRACEAALADSGAPDAVRAAIDIVA
VVRHFADSAPGMVPEGTGGCDKPPLGLAHRLGITPARAIYSIVGGQTPQSLVNEFAAAIH
AGEACCVLLSGSEAIAAAKTAARAGVAIDWNESIDGAMEDRGLGPMLLDRHELKNGVGAP
ILTYPLFEHALRARLGRSRAEHVAAMSSLWAGFSEVAAANPYAQFPKAMSAQYLATPSDS
NYPVADPYLKWHVAQDAVNQGAALILTSVAQAEAMGVPRDQWVFLHGSGEAMDKPVSLRP
DLSRSRAIEIALTGALDSAGKTASDIAHYDIYSCFPVAVLLAAEALGLDPANTALTLTGG
LPFAGGAGNNYSMHGIAAMAQTLRSDPGSFGLVLANGGFLSKEAVGIYSTTTPESWAPVD
HAPMQAEIDSEPAPTRLEEDATGVIESYTVGYAKGRPARAVVVARTPQGRVIARPADADK
DAAFAALTDPERDPIGRTVHITHADGVNGFTVAP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttcccccaataccccggtgctgatcggcgtcggccagacggtggatcactgg
gacggcagcgatcccgccgccgcgcccagcccgcaaggcctgatgcagcgcgcgtgcgaa
gcggcgctggccgatagcggtgcccccgacgcggtccgcgcggcgatcgatatcgtcgct
gtggtccgccatttcgccgacagcgcgcccggcatggtccccgaaggcaccggcggctgc
gacaagccgccgctgggcctcgctcaccggctgggcatcacccctgcacgcgcgatctat
tctatcgtcggcgggcagactccgcagtctttggtcaacgagtttgccgccgcgatccac
gcgggcgaggcatgctgtgtgctgctgtcgggatccgaagcgattgccgccgccaagacc
gccgcgcgtgcgggcgtggcgatcgactggaacgagagcatcgacggagcaatggaagat
cgcgggcttggccccatgctgctcgaccggcacgagttgaagaacggcgtcggcgcgccg
atcctcacctacccgctgttcgagcatgcgctgcgcgcccggctgggccgcagccgcgcc
gagcatgtcgcagcgatgtcgtccttgtgggctggcttcagcgaggtcgccgcggccaac
ccctatgcgcagtttcccaaagcgatgagcgcgcagtatctggcgacgccatcggacagc
aactacccggtcgccgacccctatctcaaatggcacgtcgcacaggatgcggtgaaccag
ggcgcggcgctgatcctgaccagcgtcgcccaggccgaggcaatgggtgtaccgcgcgac
cagtgggtcttcctgcacggcagcggcgaggcgatggacaagcccgtcagcctgcgcccc
gatctgtcgcggtcgcgcgcaattgagatagcgctgacaggggcgctcgacagtgcgggc
aagaccgcgagcgatatcgcgcattacgatatctacagctgcttccccgtcgcggtgctg
ctggcggcagaggcgcttgggctcgatcctgccaacaccgcgctgacgctgaccggtggg
ctgccgtttgcaggcggtgcgggtaacaattattcgatgcacggcatcgccgctatggcg
cagacgctgcgctccgaccccggcagcttcgggctggtgctggccaatggcgggttcctc
tccaaggaagcggtgggcatctacagcaccacaacgcccgagagctgggcaccggtcgat
cacgcgccgatgcaggccgaaatcgattccgagcccgccccgacaaggctggaggaggac
gcgaccggcgttatcgaaagctacaccgtgggctatgccaagggccggcccgcgcgtgcg
gtggtggtcgcgcgcaccccgcagggccgggtgatcgcccgccctgccgacgccgacaag
gacgcagccttcgccgcgctgaccgatcccgagcgcgatcccatcgggcgcacggtgcac
atcacgcatgccgatggcgtcaacggctttacggtcgccccgtga

DBGET integrated database retrieval system