KEGG   Blastomonas sp. RAC04: BSY18_2708Help
Entry
BSY18_2708        CDS       T04450                                 

Gene name
bchN
Definition
(GenBank) light-independent protochlorophyllide reductase, N subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00860  Porphyrin and chlorophyll metabolism
blas01100  Metabolic pathways
blas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSY18_2708 (bchN)
Enzymes [BR:blas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     BSY18_2708 (bchN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AOG02374
UniProt: A0A1B3NAJ3
Position
complement(2862050..2863339)
Genome map
AA seq 429 aa AA seqDB search
MITTAPTPVIADIGCSTAPVLRERGQREVFCGLTGIVWLHRKMPDAFFLVVGSRTCAHLL
QSAAGVMIFAEPRFATAIIEERDLAGLADANEELDRVVRRLLARRPEIRTLFLVGSCPSE
VIKLDLSRAAQRLAGAFLPDVRIVNYSGSGIETTFTQGEDACLASLVPFMPAQTADSGQE
LLIVGALPDIVEDQLLRLVRDIGITRVACLPARESRDLPAVGPNTRFLLAQPFLGETAQA
LEDRGAVHLPAAFPFGAEGTTDWLHAAAKAFGIDEMHFRSVVAPGRERAKRALEHSRARL
EGKTIFFLPDSQLELPLARFLHVELGMIPVEVGTPYLHRQHMAAELAQLPVGTVISEGQD
VDKQLDRVRASKPDITVCGLGLANPLEAEGFTTKWAIELVFSPIHGFDQAGDLAELFARP
IRRRDVLRV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaccgcacccacccccgtcatcgccgatatcggctgctccaccgcgcccgtg
ctgcgcgaacgcggccagcgcgaggtcttctgcgggctcacggggatcgtctggctgcac
cgcaagatgcccgacgcgttcttcctggtggtcggatcgcgcacctgcgcgcatctgctg
cagtcggctgccggcgtgatgatctttgcagagccccgctttgccaccgcgatcatcgag
gaacgcgatctggctggcctggccgatgccaatgaggaactcgatcgcgtggtgcgccgc
ctgctcgcgcgccgccccgagatccgcaccttgttcctggtcggcagctgcccgtccgaa
gtgatcaagctcgatctgtcgcgcgctgcgcagcggctcgcgggcgctttccttcccgat
gtgcggatcgtcaactattcgggcagcggcatcgagaccaccttcacccagggcgaggac
gcatgccttgcctcgctggtgccgttcatgcccgcccagaccgccgattcgggccaggag
ctgctgatcgttggcgcgctgcccgacatcgtcgaggaccagttgctgcggctggtgcgc
gacatcggcatcacccgcgtcgcctgcctgccagcgcgcgaatcgcgcgatctgcccgcg
gtcggccccaacacccgctttctgctcgcccagccctttctgggtgaaaccgcccaggcg
ctcgaagaccgcggcgcggtgcatctgcccgcagccttcccgttcggcgccgaaggcacc
accgactggctgcacgctgcggcaaaggctttcggcatcgacgagatgcatttccgcagc
gtcgtggcaccgggccgcgaacgcgccaagcgcgcgctcgagcacagccgcgcgcggctt
gaaggcaagaccatcttcttcctccccgattcgcagctcgaactgccgcttgcgcgcttc
ctgcacgtcgagctcggcatgatcccggtcgaggtcggcacgccgtatcttcaccgccag
catatggccgccgaactggcgcagctgccggtcggaacggtcatcagcgaaggccaggat
gtcgacaagcagctcgaccgcgtgcgcgcgtcgaagcccgacatcaccgtatgcggcctt
ggccttgccaatccgctcgaggccgaaggcttcaccaccaaatgggcgatcgaactggtg
ttctcgccgatccacggtttcgaccaggctggcgatcttgccgaacttttcgcacggccg
atccgccgccgcgacgtgttgagggtatag

DBGET integrated database retrieval system