KEGG   Blastomonas sp. RAC04: BSY18_3553Help
Entry
BSY18_3553        CDS       T04450                                 

Definition
(GenBank) O-methyltransferase family protein
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00906  Carotenoid biosynthesis
blas01100  Metabolic pathways
blas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    BSY18_3553
Enzymes [BR:blas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     BSY18_3553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_25 MTS Methyltransf_31 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOG00798
UniProt: A0A1B3N614
Position
3779765..3780874
Genome map
AA seq 369 aa AA seqDB search
MVGWKQRWVGWRNGIISSPAFQSWASRFPLTRPVSRVRARRLFDIIAGFTYSQTLFACVE
SGIVARLQQGAAASAELGTLARLGPDATRRLLRAAAALGLIERVGDDLWMLGEQGVALVG
NPGAIAMIRHHHLLYADLADPLSLLRGERTVPGALAGYWPYALGDGSEGEDQAAVSPYSQ
LMAASQPMVADQVVHAWRFDRHRRMLDVGGGAGAFIAAVAKVAPRLDFGLFDLPAVTAIG
ARQLGEQGIKVNPHPGDFRNDAIPTGYDLITLIRILHDHDDELAQALLIKVRASLKPGDT
LLIAEPMAGTSGAEAMADAYFGFYLLAMGSGRARTPQEIGAMLTRAGFASWRERPTGLPI
VTRVIAATA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggttggatggaagcaacgctgggtcggctggcgcaatggcatcatctcgagcccggca
ttccagtcctgggcatcgcggttcccgctgacccgcccggtgtcgcgggtgcgggcgcgc
aggctgttcgatatcatcgccgggttcacctattcgcagaccctgttcgcgtgtgtcgaa
agtggcatcgtcgcgcggctgcagcagggggctgcggcttcggctgagctgggcacgctg
gcgcgactcgggcccgatgcgacgcgccggctgctgcgtgcggcggcggcgctggggctg
atcgagcgcgtcggcgacgatctgtggatgctgggcgaacagggcgtcgctttggtcggc
aatcccggtgcgatcgcgatgatccgtcatcaccacctgctctacgccgaccttgccgat
ccgttgtcgctgctgcgcggcgagcgcaccgtgcccggcgcgctcgcaggctattggcct
tatgcgctgggcgatggcagcgagggtgaggaccaggcagcggtgtccccctattcgcag
ctgatggcggcatcgcagccgatggtcgccgatcaggttgtgcatgcctggcgattcgac
cggcacagacgcatgctcgatgtcggcggcggggcaggggcgttcatcgcggcggtggcc
aaggtcgcgccaaggctcgacttcgggctgttcgatctgcccgcggtcactgcgatcggc
gcgcggcagctgggcgaacaggggatcaaggttaacccgcaccccggcgatttccgcaac
gacgcgattcccacgggctatgacctgatcacattgatccgaatcctgcacgatcatgat
gacgagctggcccaggcgctgctgatcaaggtccgcgcctcgctcaagcccggagacacg
ttgctgatcgccgaaccgatggcgggaaccagcggcgcagaggcgatggcggacgcctat
ttcggcttctatctgctcgccatgggctcgggcagggcccgtactccgcaggaaatcggc
gccatgctgacccgcgcaggctttgcatcgtggcgggaacgacccaccgggctgcccatc
gtcacccgcgtgattgccgctaccgcctga

DBGET integrated database retrieval system