KEGG   Burkholderia latens: WK25_00080Help
Entry
WK25_00080        CDS       T04819                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
blat  Burkholderia latens
Pathway
blat00071  Fatty acid degradation
blat00072  Synthesis and degradation of ketone bodies
blat00280  Valine, leucine and isoleucine degradation
blat00310  Lysine degradation
blat00362  Benzoate degradation
blat00380  Tryptophan metabolism
blat00620  Pyruvate metabolism
blat00630  Glyoxylate and dicarboxylate metabolism
blat00640  Propanoate metabolism
blat00650  Butanoate metabolism
blat00900  Terpenoid backbone biosynthesis
blat01100  Metabolic pathways
blat01110  Biosynthesis of secondary metabolites
blat01120  Microbial metabolism in diverse environments
blat01130  Biosynthesis of antibiotics
blat01200  Carbon metabolism
blat01212  Fatty acid metabolism
blat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WK25_00080
   00630 Glyoxylate and dicarboxylate metabolism
    WK25_00080
   00640 Propanoate metabolism
    WK25_00080
   00650 Butanoate metabolism
    WK25_00080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WK25_00080
   00072 Synthesis and degradation of ketone bodies
    WK25_00080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WK25_00080
   00310 Lysine degradation
    WK25_00080
   00380 Tryptophan metabolism
    WK25_00080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WK25_00080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WK25_00080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WK25_00080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blat04147]
    WK25_00080
Enzymes [BR:blat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WK25_00080
Exosome [BR:blat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WK25_00080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Phage_lysis
Motif
Other DBs
NCBI-ProteinID: AOK02995
UniProt: A0A1B4NN26
Position
1:19613..20815
Genome map
AA seq 400 aa AA seqDB search
MIDAYICDAIRTPIGRYGGALKDVRADDLGAVPLRALIERNRDVDWTSIDDVIYGCANQA
GEDNRNVARMSALLAGLPEGVPGSTINRLCGSGMDAVGVAARAIKAGEARLMIAGGVESM
TRAPFVMGKATTAFARQADIFDTTIGWRFINPLMKQRYGVDSMPETAENVAVDYNISRAD
QDLFALRSQQKAARAQQDGTLAEEIVPVTIAQKKGDALVVSRDEHPRETSLDALAKLKGV
VRPDGSVTAGNASGVNDGACALLLANAQAADQYRLRRRARVVGMATAGVEPRVMGIGPAP
ATQKLLRQLGMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGA
SGARLVTTALHQLERTGGRFALCTMCIGVGQGIAIAIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgcctacatctgcgatgcgattcgcacccccatcggccgctacggcggcgcc
ctgaaagacgttcgagccgatgatctcggcgcggtaccgctgagggcgctgatcgaacgc
aaccgcgacgtcgactggacatcgatcgacgatgtgatctacggctgcgcgaaccaggcc
ggcgaagacaaccgcaacgtcgcgcgcatgtccgcgctcctcgcgggcttgccggaaggc
gtgccgggttcgacgatcaatcgcctgtgcggttccgggatggacgcggtcggcgtggcc
gcgcgcgcgatcaaggccggcgaagcgcgattgatgatcgcgggcggcgtcgaaagcatg
acgcgcgcaccgttcgtaatgggcaaggccaccaccgcgttcgcgcgccaggccgacatt
ttcgacacgacgattggttggcgtttcatcaatccgctgatgaaacagcgatacggtgtc
gactcgatgcccgagacggccgagaacgtggccgtcgattacaacatcagccgtgccgac
caggatctgttcgcgctgcgcagccagcagaaggccgcgcgtgcgcagcaggacggcacg
ctcgccgaagaaatcgtgccggtcacgattgcgcagaagaaaggcgatgcgctcgtcgtg
tcgcgcgacgagcatccgcgcgagacgtcgctcgacgcgctcgcgaagctgaagggcgtc
gtgcgcccggacggctccgtcacggccggcaacgcgtcgggtgtcaacgatggcgcatgc
gcgctgctgctggccaacgcgcaggccgcggatcagtatcggctgcgccgccgcgcacgc
gtcgtcggcatggcgacagcaggggtcgagccgcgggtgatgggcatcggccctgcgccg
gccacgcagaaactgttgcgccagctcggcatgacgatcgaccagttcgacgtgatcgag
ctgaatgaagcattcgcatcccagggcctcgcggtgctgcgcatgctcggcgtcgccgac
gacgatccccgcgtgaacccgaacggcggtgcgatcgcgctcggccatccgctcggcgcg
tcgggcgcacgactcgtgacgacggcgcttcaccagctcgagcgtacgggcggccgtttt
gcgctttgtacgatgtgtatcggcgtcggtcagggcatcgcaatcgcgatcgaacgcgtg
taa

DBGET integrated database retrieval system