KEGG   Burkholderia latens: WK25_00190Help
Entry
WK25_00190        CDS       T04819                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
blat  Burkholderia latens
Pathway
blat00361  Chlorocyclohexane and chlorobenzene degradation
blat00625  Chloroalkane and chloroalkene degradation
blat01100  Metabolic pathways
blat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    WK25_00190
   00361 Chlorocyclohexane and chlorobenzene degradation
    WK25_00190
Enzymes [BR:blat01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     WK25_00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AOK03015
UniProt: A0A1B4NN45
Position
1:complement(43437..44060)
Genome map
AA seq 207 aa AA seqDB search
MTIKAVVFDFGGVLIDWSPEYLYRQLIPDEAQRRWFLTHVCAMDWVARQDGGQTIDEGTR
ELVAKFPEHEALIRAFYARWHEMIGGVFDEGAALVDRLDAQGMPLFGLTNWSAQTFPYAW
DNFPVLRRFKDIVVSGHVKLVKPDPAIYREMHARIDSHVPGIAPHELVFIDDNANNAAAA
TALGWHGIHHTSAAATAARLRELGVLA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaaggcggtcgtattcgatttcggcggcgtgctgatcgactggagtcccgag
tacctgtaccggcaactgattcccgacgaagcgcagcgccgctggttcctcacgcacgtg
tgcgcgatggattgggtggctcgccaggacggtggacaaacgatcgacgaaggcacgcgc
gagctggtcgcgaagtttccggagcacgaggcgctgatccgtgcgttctatgcgcgctgg
cacgagatgatcggcggcgtgttcgatgagggcgccgcgctcgtcgaccggctcgatgcg
caggggatgccgctgttcgggctgaccaactggtccgcgcaaacatttccgtatgcgtgg
gataacttcccggtgctgcggcgcttcaaggacatcgtcgtgtcggggcatgtgaagctc
gtgaagcccgatcctgcgatctatcgcgaaatgcatgcgcggatcgattcgcacgtgccg
ggcatcgcgccgcacgagctcgtgttcatcgacgacaacgcgaacaacgcggcggctgcg
acggcgctcggctggcacgggattcatcacacgagcgcggccgcgaccgcggcgcgcttg
cgcgagctgggcgtgctcgcgtag

DBGET integrated database retrieval system