KEGG   Burkholderia latens: WK25_02295Help
Entry
WK25_02295        CDS       T04819                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
blat  Burkholderia latens
Pathway
blat00360  Phenylalanine metabolism
blat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
blat00790  Folate biosynthesis
blat01100  Metabolic pathways
blat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    WK25_02295
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    WK25_02295
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WK25_02295
Enzymes [BR:blat01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     WK25_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AOK03391
UniProt: A0A1B4NNW5
Position
1:485303..486196
Genome map
AA seq 297 aa AA seqDB search
MSTVVTAKLQEQFEAGLETRADFTIDQPLERYGQVDHAVWHQLYARQSELLRGRACDAFV
AGLGKIDLPADRVPSFADVNRQLKPATGWEIVAVPGLVPDRVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIEPVFADYMQAYGRTARAVADDEAALARLARLYWYTV
EFGLIRDPNGTNGLSIYGAGIVSSKGESLYSLESAAPNRLGFDLERVMRTKYRIDTFQKT
YFVIDDFAQLFALADVDGRALADRLAALPEFPAGAVLDTDVVLQRGTGEGWPDDADA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcgtcaccgcgaaattgcaggagcaattcgaagcgggcctcgaaacccgc
gccgatttcaccatcgaccagccgctcgaacgctacgggcaggtcgaccacgcggtatgg
catcagctctatgcgcgccagtccgagctgctgcgcgggcgcgcgtgcgacgcgttcgtt
gccgggctcggcaagatcgacctgccggccgaccgcgtgccgtcgttcgcggacgtgaac
cgccagctgaagcctgcgaccggctgggaaatcgtcgcagtgccgggcctcgtgcccgat
cgcgtgttcttcgagcacctcgcgaaccggcgtttccccgtcacatggtggatgcgccgc
ccggatcagctcgactatctgcaggaacccgactgcttccacgacctgttcggtcacgtc
ccgctgctgatcgaaccggtattcgccgactacatgcaggcatacggccgcaccgcgcgc
gccgttgccgatgacgaggcggcgctcgcgcgtctcgcgcgcctctattggtatacggtg
gaattcgggttgatccgcgacccgaacggcacgaacgggctgtcgatctacggcgccgga
atcgtttcgagcaagggcgagagcttgtacagcctcgaaagcgcggcaccgaaccggctc
ggcttcgacctggaacgggtgatgcgcacgaagtaccggatcgacacgttccagaagacc
tacttcgtgatcgacgatttcgcgcagctgttcgcgcttgccgacgtcgacggccgcgcg
ttggccgaccggctggccgcgctgccggaattcccggcgggcgcggtgctcgataccgac
gtcgtgctgcagcgcggcacgggcgaaggctggccggacgacgcggatgcctga

DBGET integrated database retrieval system