KEGG   Burkholderia latens: WK25_03535Help
Entry
WK25_03535        CDS       T04819                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
blat  Burkholderia latens
Brite
KEGG Orthology (KO) [BR:blat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WK25_03535
Enzymes [BR:blat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     WK25_03535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AOK03612
UniProt: A0A1B4NPK0
Position
1:complement(761277..762104)
Genome map
AA seq 275 aa AA seqDB search
MTDHTRSATPFRVAALQMVSTPDVARNLAEAGRLIAEAAGDGAQLVLLPEYFCFMGHRDT
DKLALAEPYRDGPIQRFLADAAQRHGIWVIGGTLPLKAPEPDRVLNTTLVFDPSGREAAR
YDKIHLFNFEKGDESFDEARTIRAGNTVVAFDAPFGKVGLSVCYDLRFPELYRRMGDCAL
IVVPSAFTYTTGRAHWEMLLRARAVENQCYVLAAAQGGKHENGRRTWGHSMLIDPWGEIV
AVRDEGASVVIGALDPQRIADVRQSLPAWRHRVLT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacacccgttccgccacgccttttcgggtggccgcgctgcagatggtgagc
acgccggacgtcgcgcgcaatctcgccgaagccggccgcctgatcgcggaagcggccggc
gacggcgcccagctcgtgctgctgcccgagtatttctgcttcatgggccaccgggacacc
gacaagctcgcgcttgccgaaccctatcgcgacggcccgatccagcggtttctggcggac
gccgcgcagcgtcacggcatctgggtcatcggcggcacgctgccgttgaaggcgccggaa
cccgatcgcgtgctgaacacgacgctcgtgttcgacccgtccggccgcgaggccgctcgc
tacgacaagatccatctgttcaacttcgagaaaggcgacgaatcgttcgacgaggcgcgc
acgatccgcgcgggcaacaccgtcgttgcattcgacgcgccgttcgggaaggtcggcctg
tcggtctgttacgatctgcgctttccggagctgtatcgcaggatgggcgactgcgcgctg
atcgtcgtgccgtcggcgtttacgtacacgaccggccgcgcgcattgggaaatgctgctg
cgcgcgcgggccgtcgagaaccagtgttacgtgctcgcggccgcgcaaggcggcaagcac
gagaacggccggcgcacctggggccacagcatgctgatcgacccgtggggtgagatcgtc
gcggttcgcgacgaaggcgcgagcgtcgtgatcggcgcgctcgatccgcagcgcatcgcc
gacgtgcgccagagcctgcccgcgtggcggcatcgcgtgctgacctga

DBGET integrated database retrieval system