KEGG   Burkholderia latens: WK25_10685Help
Entry
WK25_10685        CDS       T04819                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
blat  Burkholderia latens
Pathway
blat00471  D-Glutamine and D-glutamate metabolism
blat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WK25_10685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blat01011]
    WK25_10685
Enzymes [BR:blat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     WK25_10685
Peptidoglycan biosynthesis and degradation proteins [BR:blat01011]
 Precursor biosynthesis
  Racemase
   WK25_10685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AOK04883
UniProt: A0A1B4NT92
Position
1:2309241..2310101
Genome map
AA seq 286 aa AA seqDB search
MSNQPADSGARPAAAPIGIFDSGLGGLSVLRAVRAHLPGESFIYVADSHHAPYGPRDEAF
ITERTLAIGEWLAREGAKALVIACNTATARAIAAVRERLSIPLVGVEPGIKPAAALSASG
VAGVLATQSTLNSPRFQALLDRYGAGRRFICQPGHGLVEAIERGDTNSPALRALLDGYLQ
PMLDDGADTLVLGCTHYPFFTETIRDLVGDRLTIVDTSDAIARQLGRVLDERALRAPAGT
RAAPPRFCSTSDGRQLRALASTLLGLDASVESVTISSPNARPCATA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcagccagccgattccggggctcgccccgccgccgcgcccatcggaattttc
gattcggggctcggcggcctgtcggtgctgcgcgcggtgcgcgcgcacctgcccggcgag
tcgttcatctacgtcgcggattcccatcacgcgccttatggtccgcgcgacgaagcgttc
attacggaacgcacgctggcgatcggcgagtggcttgcgcgcgaaggggcgaaagcgctc
gtcattgcatgcaacaccgcgacggcgcgcgcgatcgctgccgtccgcgaacgcctgtcg
ataccgctcgtcggcgtcgagccgggcatcaaaccggccgccgcgctgtccgcgagcggc
gtcgccggcgtgcttgccacgcagtcgacgctgaacagtccgcgcttccaagcgctgctc
gaccgctacggcgccggccggcgcttcatttgccagcccggccacgggctcgtcgaggcg
atcgaacgcggcgacacgaattcgcccgcgttgcgcgcgttgctcgacggttacctgcag
ccaatgctcgacgacggcgcagacacgctggtactcggctgcacgcactatccattcttc
actgaaaccattcgcgacctggttggcgaccgcctgacgatcgtcgacaccagcgacgcg
atcgcccgccagctcgggcgagtactcgacgaacgcgcgctgcgggcgccggccggcacg
cgtgccgcaccgccacgattctgctcgacgagcgacggccgccagctgcgtgccctcgct
tcgacactgctcggcctcgacgcatcggtcgaatcggtcaccatttcgtcgccgaacgcc
cgcccctgcgcgaccgcctga

DBGET integrated database retrieval system