KEGG   Burkholderia latens: WK25_11660Help
Entry
WK25_11660        CDS       T04819                                 

Definition
(GenBank) histidine ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
blat  Burkholderia latens
Pathway
blat02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:blat00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WK25_11660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blat02000]
    WK25_11660
Transporters [BR:blat02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    WK25_11660
   Histidine transporter
    WK25_11660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 ASC
Motif
Other DBs
NCBI-ProteinID: AOK05054
UniProt: A0A1B4NTR8
Position
1:2509993..2510682
Genome map
AA seq 229 aa AA seqDB search
MFLQGYGPLILAGTWQTVKLAVLSLALSFVLGLLGAGAKLSRNRFTNGVGTVYTTLIRGV
PDLVLMLLLFYSLQIWLNVATDALGWDQIDIDPFLAGVLVLGFIYGAYFTETFRGAFLSV
PRGQLEAGSAYGMTNWQVFTRIMFPQMMRFALPGIGNNWQVLVKSTALVSIIGLADVVKA
SQDAGKGTLRFFFFTLIAGAVYLAITTISNFVLMWLEKRYSTGVRKADL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtttctacaaggctacggcccgctgatcctcgccggcacctggcagaccgtcaaactg
gcggtgctttcgctcgcgctgtcgttcgtgctgggcctgctcggcgcgggcgcgaagctg
tcgcgcaaccgcttcacgaacggcgtcggcaccgtctacacgacgctgatccgcggcgtc
cccgatctcgtgctgatgctgctgctgttctacagcctgcagatctggctgaacgtcgcg
accgacgcgctcggctgggaccagatcgacatcgacccgttcctcgcgggcgtgctcgtg
ctggggttcatctacggcgcatatttcaccgagactttccgcggcgcgttcctgtcggtg
ccgcgcggccagctcgaggccggcagcgcgtacgggatgaccaactggcaggtgttcacg
cgcatcatgttcccgcagatgatgcgcttcgcgctgccgggcatcggcaacaactggcag
gtgctcgtgaagtcgaccgcactcgtgtcgatcatcggcctcgcggacgtcgtgaaggcg
tcgcaggacgccggcaaaggcacgctgcggttcttcttcttcacgctgatcgccggcgcc
gtctacctcgcgatcacgacgatctcgaatttcgtgctgatgtggctcgaaaagcgctac
tcgaccggtgtccgcaaggctgacctatga

DBGET integrated database retrieval system