KEGG   Burkholderia latens: WK25_11670Help
Entry
WK25_11670        CDS       T04819                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
blat  Burkholderia latens
Pathway
blat02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:blat00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WK25_11670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blat02000]
    WK25_11670
Enzymes [BR:blat01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     WK25_11670
Transporters [BR:blat02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    WK25_11670
   Histidine transporter
    WK25_11670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_13 AAA_16 AAA_15 APS_kinase Zeta_toxin AAA_33 AAA_22 PRK G-alpha RsgA_GTPase RYDR_ITPR AAA_23 ATPase_2 AAA_30 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AOK05056
UniProt: A0A1B4NTQ7
Position
1:2511411..2512190
Genome map
AA seq 259 aa AA seqDB search
MNSQTQKLFVDDLHKRYGDNEVLKGVSLKANSGDVISVIGSSGSGKSTMLRCINFLEQPN
AGRIFVDGEEVRTALDKTGALRAADPKQLQRVRTKLSMVFQHFNLWSHMNVIENVMEAPV
NVLGIPKKEAEDRAREYLEKVGLAPRVEKQYPSHLSGGQQQRVAIARALAMHPDVMLFDE
PTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEEGVPSE
VFANPKSERLRAFLSGSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaattcccagactcaaaagcttttcgtcgacgatctccacaagcggtacggcgacaac
gaggtgctcaagggcgtgtcgctgaaggcgaactcgggcgacgtgatcagcgtgatcggc
tcgtccggttccggcaagagcacgatgctccgctgcatcaacttcctcgagcagccgaac
gcgggccgcatcttcgtcgacggcgaggaagtccggaccgcgctcgacaagacgggcgcg
ctgcgcgcggccgatccgaagcaactgcagcgcgtgcgcacgaagctgtcgatggtgttc
cagcacttcaatctgtggtcgcacatgaacgtgatcgagaacgtgatggaagcgcccgtc
aacgtgctcggaatcccgaagaaggaagccgaggatcgcgcgcgcgagtatctcgagaaa
gtcggcctcgcgccgcgcgtcgaaaagcagtatccgtcgcacctgtcgggcggccagcag
cagcgcgtcgcgatcgcgcgcgcgctcgcaatgcatccggacgtgatgctgttcgacgaa
ccgacttccgcactcgatccggaactcgtcggtgaagtgctgaaggtgatgcaaaagctc
gccgaggaaggccgcacgatgatcgtcgtcacgcacgagatgggcttcgcgcgcaacgtg
tcgaaccacgtgatgttcctgcaccaggggcgcgtggaagaagaaggcgtaccgtccgag
gtgttcgcgaatccgaagagcgagcgcctgcgcgcgttcctgtcgggcagcctgaagtaa

DBGET integrated database retrieval system