KEGG   Burkholderia latens: WK25_13625Help
Entry
WK25_13625        CDS       T04819                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
blat  Burkholderia latens
Pathway
blat00520  Amino sugar and nucleotide sugar metabolism
blat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    WK25_13625
Enzymes [BR:blat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     WK25_13625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 HemolysinCabind
Motif
Other DBs
NCBI-ProteinID: AOK05418
UniProt: A0A1B4NUW2
Position
1:complement(2938744..2939847)
Genome map
AA seq 367 aa AA seqDB search
MLTGNILTPDGWIHGSIDSENGRIAALDGTPVEPAKNDAPYILPGFIDLHVHGGGGADVM
EGGDAIDTIARTHAQFGTTSLLATTMTAPRDELMEVVANLGIAARTRTPGAARVLGVHLE
GPYINPGKLGAQPDAAVSAVLDEVLKYLSIAPIRVVTLAPEIAGHIEIIGEMAARGVRVQ
LGHSLATYDDAVAALKHGACGFTHLFNAMSPLHHRNPGLVGAALAHAEYAEIIPDLLHVH
PGAIRAALRAIPRLYVVTDSTSATGMPDGEYRLGSQHVTKCLGGVRLADGTLAGSTLTMD
QALRNLVSLGLPIADVSNRMSRYAADYLGIADRGRLERGAWADLAVFDRDLNLTATYVEG
ESIVEYA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctgactggaaacatcctgacccccgacggctggattcacggctcgatcgacagcgaa
aacggccgcatcgccgcgctcgacggcacccctgtggagcctgcgaagaacgacgcgccg
tacatcctgcccggcttcatcgacctgcacgtgcatggcggcggcggcgccgacgtgatg
gaaggcggcgacgcgatcgacacgatcgcgcgcacgcacgcgcaattcggcacgacgagc
ctgctcgcgacgacgatgaccgcgccccgcgacgaactgatggaagtcgtcgcgaacctc
ggcatcgcggcgcgcacgcgtacgcccggcgccgcgcgcgtgctcggcgttcacctcgaa
ggcccgtacatcaaccccggcaagctcggcgcgcagcccgacgcggcggtgtcggccgta
ctcgacgaagtgctgaagtacctgtcgatcgcaccgatccgcgtcgtcacgctcgcgccg
gaaatcgccggccacatcgagatcatcggcgagatggccgcgcgcggcgtgcgcgtgcag
ctcggccactcgctcgcgacttacgacgacgccgtcgccgcgctcaagcatggcgcatgc
gggttcacgcacctgttcaacgcgatgtcgccgctgcatcaccgcaatccgggcctcgtc
ggcgcggcgctcgcgcatgccgagtacgcggaaatcatccccgatctgctgcacgtgcat
cccggcgcgatccgcgctgcgctgcgcgcgatcccgcgcctgtacgtcgtgaccgacagc
acgtccgccaccggcatgcccgacggcgaataccggctcggcagccagcatgtgacgaag
tgtctcggcggcgtgcggctcgccgacggcacgctcgccggcagcacgctgacgatggat
caggcgctgcgcaatctcgtgtcgctcggcctgccgatcgccgacgtttcgaaccggatg
tcgcgctatgcggccgactatctcggcatcgccgatcgcgggcgcctcgagcgcggcgcg
tgggccgacctcgcggtgttcgatcgcgacctgaacctcaccgcgacctacgtcgaagga
gaatcgattgtcgaatatgcttaa

DBGET integrated database retrieval system