KEGG   Burkholderia latens: WK25_15125Help
Entry
WK25_15125        CDS       T04819                                 

Definition
(GenBank) 2-dehydro-3-deoxyglucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
blat  Burkholderia latens
Pathway
blat00053  Ascorbate and aldarate metabolism
blat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    WK25_15125
Enzymes [BR:blat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     WK25_15125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI Ubiq-Cytc-red_N
Motif
Other DBs
NCBI-ProteinID: AOK05686
UniProt: A0A1B4NVG1
Position
1:complement(3264306..3265091)
Genome map
AA seq 261 aa AA seqDB search
MSTLTNSLKQRLRDGDEPLYGLWLSLGCDSVAEALAHAGYDWLCIDMEHAPNDSRDVASQ
LRALAAAHLPSEPVVRVPGREPWLVKRALDAGARTLMFPCVETSDEAAHAVRLTRFPSPD
SPDGLRGVAGMVRAAAYGMRREYLQTANAQVAVIVQIESARGIDEVERIAATPGIDCLFV
GPADLAASLGHLGDSRHPDVEAAMARVLAAGKHAGVAVGIFASDTASARQYREAGYRMIT
LSADVTWLLRATRQALQEARS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgctcaccaattccctcaagcagcgtctgcgcgacggcgacgagccgctgtat
ggcctgtggctgtcgctcggatgcgattcggtcgcggaagcgctcgcgcacgccggctac
gactggctctgcatcgacatggagcacgcgccgaacgacagtcgcgacgtcgcatcgcag
ctgcgcgcgctggccgccgcgcatctgccgagcgagcccgtcgtccgcgtgccggggcgc
gagccgtggcttgtgaagcgcgcgctcgacgccggcgcgcgcacgctgatgttcccttgc
gtcgagacgtccgacgaggccgcgcacgcggtgcggctcacgcgctttccgtcgccggat
tcgccggacgggctgcgcggcgtcgccgggatggtacgggcggccgcatacggcatgcgc
cgcgagtacctgcagaccgcgaacgcgcaggtcgcggtgatcgtgcagatcgaatcggcg
cgcgggatcgacgaagtcgagcggatcgccgcgacgccgggcatcgactgcctgttcgtc
ggcccggccgatttggcggcgagcctcgggcatctcggcgacagccgtcacccggacgtc
gaagccgcgatggcgcgcgtgctcgcggcaggcaagcacgccggcgtcgcggtcggcatc
ttcgcgagcgatacggcgagcgcgcggcaatatcgcgaggcaggctaccggatgattacg
ctgtctgccgacgtgacctggctgctgcgcgcgacacggcaggcgctgcaggaggcacgg
tcatga

DBGET integrated database retrieval system