KEGG   Blautia sp. N6H1-15: DQQ01_10155Help
Entry
DQQ01_10155       CDS       T05518                                 

Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
blau  Blautia sp. N6H1-15
Pathway
blau00620  Pyruvate metabolism
blau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DQQ01_10155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blau02000]
    DQQ01_10155
Enzymes [BR:blau01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     DQQ01_10155
Transporters [BR:blau02000]
 Other transporters
  Primary active transporters [TC:3]
   DQQ01_10155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AWY99462
UniProt: A0A2Z4UEG6
Position
complement(2073314..2074726)
Genome map
AA seq 470 aa AA seqDB search
MADVVKKPIKITETILRDAHQSLIATRMTTEQMMPIVEKLDKVGYHSVECWGGATFDASL
RFLKEDPWERLRKFRDGFKNTKLQMLFRGQNILGYRPYADDVVEYFVQKSIANGIDIIRI
FDCLNDLRNLQTAVKAANKEKGHAQVALSYTLGDAYTLDYWVDMAKKVEDMGANSICIKD
MAGLLLPYKATELVTALKEAVDIPIQLHTHYTSGVASMTYLKAVEAGVDVIDTAMSPFAL
GTSQPATEVMVETFKGTPYDTGFDQQLLAEIADYFRPIRDEALDSGLLNPKNLGVNIKTL
LYQVPGGMLSNLTSQLKEQHAEDKFYDVLEEVPRVRKDLGEPPLVTPSSQIVGTQAVFNV
IMGERYKMVTKETKDVLSGKYGATVKPFDKEVQKKCIGDAEVITCRPADLLQPELDTLRG
EMAQWSEQEEDVLSYALFPQVATDFFKYREAQQTKVDPKEADTENGAYPV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtagtaaagaaaccaattaaaattactgaaacaattctgcgtgacgcacat
caatctctgattgcaacaagaatgacaacagagcagatgatgccaatcgtagaaaaactg
gataaagtcggctaccattccgtagagtgctggggtggagctacctttgatgcttccctg
cgtttcttaaaggaagatccatgggaaagacttcgtaaattccgtgatggctttaaaaat
acaaaattgcagatgttattccgtggacagaacattttaggttaccgtccatacgcggat
gacgtagtagaatactttgtgcagaaatctattgcaaacggtattgatatcattcgtatt
ttcgactgtttaaatgaccttcgcaatctgcagacagcagtaaaggcagcaaacaaagaa
aaagggcatgcacaggttgctctgtcttatactctgggtgacgcctatactctggactac
tgggtagatatggcgaaaaaggttgaggatatgggtgcaaactccatctgtatcaaagat
atggctggtttattgcttccatataaagcaacagagcttgtaacagcattaaaagaagcg
gttgatattccgattcagcttcatacacactatacctcaggagttgcttccatgacttac
ttaaaagcagtagaagcaggcgtagatgttattgatacagctatgtcaccatttgcactg
ggaacatctcagccggcaacagaggttatggttgaaacctttaagggaacaccttatgat
acaggctttgatcagcagttattggcagaaatcgctgattacttccgtccaatccgtgac
gaggcattagacagcggtctgttaaatccgaagaacctgggtgtaaacattaagacactg
ttatatcaggtaccgggcggtatgctttccaatctgacatctcagttaaaagaacagcat
gcagaagacaagttctacgatgttctggaagaggttccgagagttcgtaaagaccttggt
gaaccgcctctggttaccccatcttcccagattgtgggtacacaggctgtatttaacgtt
atcatgggcgaacgctacaaaatggtaacaaaagaaacaaaagatgtattaagcggaaaa
tacggtgcaacagtaaaaccgtttgataaagaagtacagaaaaaatgtattggtgatgca
gaagttatcacctgccgtcctgcggatttacttcagccggaactggataccttgagaggc
gaaatggcgcagtggtccgaacaggaggaagacgtactgtcttacgcactgttcccacag
gttgctacagacttcttcaaatacagagaagcacagcagactaaggtagatccaaaggaa
gcggatacagaaaacggagcttatccggtataa

DBGET integrated database retrieval system