KEGG   Blautia sp. N6H1-15: DQQ01_14915Help
Entry
DQQ01_14915       CDS       T05518                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
blau  Blautia sp. N6H1-15
Pathway
blau00450  Selenocompound metabolism
blau00970  Aminoacyl-tRNA biosynthesis
blau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DQQ01_14915
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DQQ01_14915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:blau01007]
    DQQ01_14915
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:blau03016]
    DQQ01_14915
Enzymes [BR:blau01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DQQ01_14915
Amino acid related enzymes [BR:blau01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DQQ01_14915
Transfer RNA biogenesis [BR:blau03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DQQ01_14915
 Prokaryotic type
   Other AARSs
    DQQ01_14915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind Anticodon_1 tRNA-synt_1f tRNA-synt_1e VRP1
Motif
Other DBs
NCBI-ProteinID: AWY99195
UniProt: A0A2Z4UDN4
Position
complement(3079094..3081061)
Genome map
AA seq 655 aa AA seqDB search
MDKKKYYITTAIAYTSGKPHIGNTYEAVLADSIARFKRQQGYDVFFQTGTDEHGQKIELK
AAEAGVTCKEFVDNVAGEIKSIWDLMNTSYDKFIRTTDEDHEKQVQKIFKKLYDQGDIYK
GYYEGMYCTPCESFFTESQLVDGKCPDCGRPVTPAKEEAYFFRMSKYAQRLIDHINTHPE
FIQPVSRKNEMMNNFLLPGLQDLCVSRTSFKWGIPVDFDPKHVVYVWLDALTNYITGIGY
DCDGESTEQFKKDWPADLHLIGKDIIRFHTIYWPIFLMALDLPLPKQVFGHPWLLQGDGK
MSKSKGNVIYADQLVDFFGVDAVRYFVLHEMPFENDGVITWELMVERLNSELANTLGNLV
NRTISMSNKYFGGEVKNTNVCEPVDEELKAVVLETKAKVAAKMEELRVADAITEIFTLFK
RCNKYIDETMPWALAKDEEKKDRLATVLYNLVEGICIGASLLESFMPETTEKILAQLNAG
KRTYEELDTFGLYPSGNKVTEKPEILFARLDVKEVLEKVEEMRAKEAAQNAPEEAKEEAP
VIDIEAKEEVTFDDFMKMQFQVGEIIACEEVKKSKKLLCSQVKIGSQVKQIVSGIKAHYK
PEDMVGKKVMVLVNLKPAKLAGILSEGMILCAEGQDGELALMTPEKEMPAGAEIC
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtggataagaagaaatattatattacaacagccattgcctatacatcaggcaaacctcat
attggaaatacttatgaggcagtgctggcagacagcatcgcaagatttaaaagacagcag
ggttatgatgtctttttccagacaggaacagatgagcatggacagaaaattgaattaaag
gcagcagaagccggtgtgacctgcaaggaatttgtagacaatgtggcaggagaaattaag
agcatctgggatttgatgaacacttcctatgacaaatttatccgtaccacagacgaagac
catgaaaaacaggtgcagaagattttcaaaaagctgtatgaccagggggacatttacaaa
ggctattatgaaggtatgtactgtactccctgtgaatccttctttacagaatctcagtta
gtagacggcaaatgtccggactgcggacgtccggtaactcctgcaaaggaagaagcatat
ttcttcagaatgagcaaatatgcacagcgtctgattgatcacatcaatacacacccggaa
tttattcagccggtatccagaaagaatgagatgatgaacaactttcttctgccgggatta
caggacttatgtgtatccaggacttcctttaaatggggaattccggtagattttgaccca
aaacatgtggtctatgtatggttggacgctttgacaaactatatcacaggaatcggttat
gactgtgacggagaaagcacagagcagtttaaaaaggactggcctgcagacctgcactta
atcggaaaggacattatccgtttccatactatttactggccgattttcttaatggctctg
gatttgccgttgccgaaacaggtttttggacatccatggcttctgcagggtgacggaaag
atgagtaaatccaaaggaaatgtaatttatgcagatcagcttgtggatttctttggtgtg
gacgcagtgcgttactttgtacttcacgaaatgccttttgaaaatgacggtgtgattacc
tgggaattaatggtagaacgtttgaattccgagctggcaaacactctgggaaatctggta
aacagaactatttccatgtccaacaaatattttggaggagaagtgaaaaacaccaatgtc
tgcgaaccagtagatgaggaattaaaggcagttgtactggaaacaaaggcaaaagtagcg
gcaaaaatggaagagcttcgagtggcagacgccattacagaaatctttactctttttaaa
cgttgcaataaatatattgacgaaaccatgccatgggctctggcaaaggatgaagaaaag
aaagaccgtctggcaacagttctctacaacctggtagagggtatctgcattggcgcttct
cttctggaatcctttatgccggaaactacagaaaagattctggcacagttaaatgcagga
aagagaacttatgaagaactggatacctttggtttatatccgtcaggcaataaagtgaca
gaaaaaccggaaatcctctttgcccgtctggacgtaaaagaggtgttggaaaaggtagaa
gaaatgagagcaaaggaagctgctcagaatgcaccggaggaggcaaaggaagaagctcct
gtcattgatatagaagcaaaagaagaggttacctttgacgactttatgaaaatgcagttc
caggtaggagaaatcattgcctgcgaggaagtgaaaaaatcaaaaaaactgctgtgttct
caggtgaaaatcggaagccaggtaaaacagattgtgtccggaatcaaagcgcactataaa
ccagaagacatggtgggcaaaaaggttatggttctggtgaacttaaaacctgccaagctg
gcaggaatcctgtcagaaggtatgattctctgcgcagaagggcaggacggagagctggcg
cttatgacaccggagaaagagatgccggcaggagcggaaatctgctaa

DBGET integrated database retrieval system