KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_106Help
Entry
BBMN68_106        CDS       T01345                                 

Definition
(GenBank) Trans-aconitate methyltransferase-like hypthetical protein
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Brite
KEGG Orthology (KO) [BR:blb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBMN68_106
Enzymes [BR:blb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     BBMN68_106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADQ02026
Position
124749..125132
Genome map
AA seq 127 aa AA seqDB search
MQTPMNYEEPIHRIIGGIVHSPAFADKLPQQREFYNLTPPEYWELLHAHASAFRMWKVTY
MHTLPSHEAVMDWYRGTGMRPYLQALDDAGRKKFEAEVFAQVREEYPTQSDGSIIFPFPR
FFFLATR
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacgccgatgaactatgaggagccgattcaccgcatcatcggtggtatcgtgcac
tcgcccgcgttcgcggacaagctgccgcagcaacgcgagttctacaacctcacgccgccc
gaatactgggagctgctgcatgcgcatgccagcgccttccgcatgtggaaggtcacgtac
atgcacacgctgccctcgcatgaggcggttatggactggtatcgtggcaccggcatgagg
ccgtatctgcaagcgcttgatgacgccgggcgcaagaagttcgaggccgaagtgttcgcc
caagtccgcgaggaataccccacacagtcggacggcagcatcatcttccccttcccacgt
ttcttcttcctcgcgactcggtag

DBGET integrated database retrieval system