KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_534Help
Entry
BBMN68_534        CDS       T01345                                 

Gene name
pyrB
Definition
(GenBank) PyrB
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
blb00240  Pyrimidine metabolism
blb00250  Alanine, aspartate and glutamate metabolism
blb01100  Metabolic pathways
Module
blb_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:blb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBMN68_534 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBMN68_534 (pyrB)
Enzymes [BR:blb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BBMN68_534 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADQ03253
Position
complement(607968..608930)
Genome map
AA seq 320 aa AA seqDB search
MVGKSVVTLDGLSTNQILDLLHKAEYIDSHRKEIAHTCDGRVLATLFYEPSTRTRLSFET
AMLRLGGKVIGFAGAQLASVTKGESIADTLKTVSNYVDVVAIRHPKEGAALVASRAASVP
VINAGDGGHMHPTQTLADLATLQSRFGRITDLTVGLCGDLTFGRTVHSLIETLCRFGNVR
FVLISPDELKTPQYVIDRINATDSCSYVEVRDLASVIGDLDVLYMTRVQKERFFNEDDYL
RLRDTYILDEEKLQLAKPSMAVLHPLPRVNEIAVDVDDDPRAAYFEQVKNGMLVRMALES
TVVGDELPGYEPLNPKEVQA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcaaaagcgtcgtaacgctggacggcctgtctacaaaccagattctcgacctg
ctgcataaggccgaatacatcgattcccaccgcaaagagattgcccatacctgcgatggg
cgagtgctggccacgctgttctacgagccctccacccgtacgcgcctgagctttgagacc
gcaatgctacgtctcggcggcaaggtcatcggattcgccggcgcgcagctggcctccgtg
accaagggcgaatccatcgccgacacgttgaagaccgtgtccaactacgtggacgtggtc
gccatccgtcacccgaaggagggtgccgcgctggtggcctcccgcgccgcatccgtgccg
gtaatcaacgccggcgacggcggccacatgcaccccacgcagacgctggccgacctggcc
acgctgcagtcgcgcttcggccgcatcaccgacctgaccgtgggactgtgcggcgatttg
accttcggccgcaccgtgcactccctgatcgagaccctgtgccgcttcggcaacgtgcgc
ttcgtgctcatcagcccggacgagctcaagaccccgcagtacgtgatcgaccgcatcaac
gccaccgacagctgctcctacgtggaagtgcgcgacctggcctccgtgatcggcgacctc
gacgtgctgtacatgacccgcgtacagaaggaacgcttcttcaacgaagacgactacctg
cgcctgcgcgacacctacattctcgacgaagagaagctgcagctcgccaagccgtccatg
gccgtgcttcacccgctgccgcgcgtcaacgaaatcgccgtggacgtggacgacgacccg
cgtgccgcctacttcgaacaggtcaagaacggcatgctcgtgcgcatggccctcgaaagc
accgtggtgggcgacgaactgcccggatacgaaccgctcaaccccaaggaggttcaggcc
tga

DBGET integrated database retrieval system