KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_647Help
Entry
BBMN68_647        CDS       T01345                                 

Gene name
pitA
Definition
(GenBank) PitA
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Brite
KEGG Orthology (KO) [BR:blb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BBMN68_647 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADQ03375
Position
complement(731752..732804)
Genome map
AA seq 350 aa AA seqDB search
MDVSLAHFLQQVLSNPALTVTTLLTLGVIFVNGWTDAPNAIATCVTTRCMRVRSAVIMAA
IFNFLGVFIMTQLNASVASTISNMVDFGGDTNAALIALCAALFSIVVYSVGASLLGIPTS
ESHSLIAGLSGAAIAIQGGIGGINMGEWVKVLYGLVASLLFGFAVGWLVCKAVTLICAGM
DRRRTNGFFTYAQIVGAAAMSFMHGAQDGQKFIGVLFLGMAFCNGQPSVTGVMIPIWLMI
LCSTIMGVGTSVGGERIIKSVGQDMVKLEKYQGFSADLSSALCLLVMTVLGIPVSTTHTK
TSAIMGVGAVRRLSAINFGVVRDMMLTWVFTFPGCGLISFVMAKLFMVVF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttggacgtctcactggcgcatttcctccaacaagtgctttccaacccggctctgaccgtc
acaacgttgctgacgctgggagtcatcttcgtcaacggctggaccgacgcacccaacgcc
atcgccacctgcgtgaccacacgatgcatgcgcgtacgctccgccgtcatcatggcggcc
atcttcaacttcctcggcgtcttcatcatgacgcagctcaacgcctccgtggcctccacc
atcagcaacatggtcgatttcggcggcgacacgaacgcggcgctcatcgccctatgcgcg
gcgctgttctccatcgtcgtatacagcgtgggcgcctcgctgctcggcatacccacctcc
gaaagccacagcctgatcgccggcctgtccggagcggccatcgccatccaaggcggcatc
ggcggcatcaacatgggagaatgggtcaaggtgctctacggtctggtcgcaagcctcctg
ttcggcttcgccgtcggctggttggtatgcaaggccgtgaccctgatttgcgctggcatg
gaccgccgccgcaccaacgggttcttcacctacgcgcagatcgtgggcgcggcggccatg
agcttcatgcacggcgcgcaggacggccagaagttcatcggcgtgctgttcctcggcatg
gcgttctgcaatggccaacccagcgtgaccggtgtgatgattccgatctggctcatgatt
ctgtgcagcaccatcatgggcgtgggcacgtccgtcggcggtgaacgcatcatcaaatcc
gtgggccaggacatggtgaaactcgagaaataccaaggcttctcggccgatctgtcaagc
gcgctgtgcctgctcgtcatgaccgtgctcggcatccccgtctccaccacgcacaccaag
accagcgccatcatgggcgtgggcgcggtacgccgcctctccgccatcaacttcggcgtg
gtgcgcgacatgatgctcacctgggtgttcaccttccctggttgcggtctcatcagcttc
gtaatggccaaactgttcatggtcgtgttctag

DBGET integrated database retrieval system