KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_850Help
Entry
BBMN68_850        CDS       T01345                                 

Gene name
gly1
Definition
(GenBank) Gly1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
blb00260  Glycine, serine and threonine metabolism
blb01100  Metabolic pathways
blb01110  Biosynthesis of secondary metabolites
blb01120  Microbial metabolism in diverse environments
blb01130  Biosynthesis of antibiotics
blb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBMN68_850 (gly1)
Enzymes [BR:blb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BBMN68_850 (gly1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADQ03600
Position
975982..977007
Genome map
AA seq 341 aa AA seqDB search
MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIREACGQPDADVWFLVG
GTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLTIPQHNGKMDPTELDEF
CKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVAHKYDMPLFVDGARLGYA
LTTTGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNTPKHFLTLIKQHGALLAKG
FVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTLTFEAPTNQIFVTMDQPTID
RLEREIKLGFTEKADDTHTVMRICTSWATTPEEVDQLIELL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttttgagaacgattactcccgcgccgcccatcccgcggtgcttgaagccgtg
gctgaagccaacaaccatctgtattcgggctacgggtccgacgaactgagcgatcaggcc
aaggccaagatccgcgaggcctgcggccagccggacgcggatgtgtggttcctcgtcggc
ggcacgcagaccaaccaggtcgtcatcgacaccatcaccccggcgtatgcaggcgtggtc
gcggtcgcctccggccatccgaacgtgcacgaggccggcgccatcgagttctccgggcac
aaggtgctcacgattccccagcacaacggcaaaatggacccgaccgaactggacgagttc
tgcaagaccttctatgcggacggcaactacgagcacatggtgttcccgggctccgtgtac
gtctcgcaaagcaccgaatatggcaccatctactccaaggccgagttgcaggccatcgcc
gatgtggcgcacaagtacgacatgccgctgttcgtggacggagcgcgactcggctacgcg
ctgaccaccaccggctcagacatgacgctcgcggatctggcgaccatcgccgacgtgttc
tacatcggcggtaccaaggtgggtgccctgttcggcgaggccgtggtgtttaccaagcac
aacacgccgaagcacttcttgaccctcatcaagcagcacggtgccttgctggccaagggc
tttgtgctgggcgcgcagtttgacgctttgttcaccgacaacctgtatttcaagatcgcc
cgcaacgccaatgaggcggccgatcgtattcgcgaggccctgcgcgccaagggctacacg
ctcactttcgaagcgcccaccaaccagattttcgtgacgatggatcagccgaccatcgac
cgtctggagcgcgagatcaagctcggctttaccgaaaaggccgacgacacgcacaccgtg
atgcgcatctgcaccagctgggccaccacgcctgaagaggtcgatcaacttattgagttg
ttgtaa

DBGET integrated database retrieval system