KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1083
Entry
Balac_1083        CDS       T00923                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
blc00620  Pyruvate metabolism
blc00640  Propanoate metabolism
blc00650  Butanoate metabolism
blc01100  Metabolic pathways
blc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Balac_1083
   00640 Propanoate metabolism
    Balac_1083
   00650 Butanoate metabolism
    Balac_1083
Enzymes [BR:blc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Balac_1083
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACS46439
Position
complement(1240510..1242888)
AA seq 792 aa
MSAIENVAEVSPEAIKEQAWEGFVPGNWEKDIDVRDFIQKNYTPYEGDESFLADATDKTK
YLWKYLDDNYLAVERKQRVYDVDTHTPADIDAFPAGYIDSPEIDNVIVGLQTDEPCKRAM
MPNGGWRMVEQAIKEAGKEPDPAIKKIFTKYRKTHNDGVFGVYTKNIKVARHNKILTGLP
DAYGRGRIIGDYRRVALYGVDALIKFKQRDKDAIPYRNDFSETEIEHWIRYREEHDEQIK
ALKKLINLGKEYGLDLARPAMNAREAVQWTYMGYLASIKSQDGAAMSFGRVSAFFDIYFE
RDLKEGKITETDAQEIIDNLVMKLRIVRFLRTKDYDSIFSGDPYWATWSDAGFGDDGRTM
VTKTSFRLLNTLTLEHLGPGPEPNITIFWDPKLPEGYKRFCAQISIDTSAIQYESDKEIR
NHWGDDAAIACCVSPMRVGKQMQFFAARVNSAKALLYAINGGRDEMTGMQVIDKGIIEPI
QPEADGTLDYEKVKANYEKALEWLSETYVEALNIIHYMHDKYAYESIEMALHDREVYRTL
GCGMSGLSIAADSLSACKYAKVYPIYNKDAKDMPGHEYEYVEGADDDLVVGYRTEGEFPL
YGNDDDRADDIAKWVVSTVMGQVKRLPVYRGAVPTQSILTITSNVEYGKNTGSFPSGHAK
GTPYAPGANPENGMDSHGMLPSMFSVGKIDYNDALDGISLTNTITPDGLGRDEDERISNL
VGILDAGNGHGLYHANINVLRKEQLEDAVEHPEKYPHLTVRVSGYAVNFVKLTKEQQLDV
ISRTFHQGAVED
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgtcagcaattgaaaacgtggccgaggtgtccccggaagccatcaaggaacaggcttgg
gaggggttcgttcccggcaactgggagaaggacatcgacgttcgtgacttcattcagaag
aactacacgccttacgagggtgatgaatcgttcctcgcggatgcgaccgacaagacgaag
tacctgtggaagtacctcgacgacaactatctggcggtggagcgcaagcagcgtgtctat
gatgtggacacccacacgccggcggatatcgacgccttcccggctggctatatcgattcc
ccggagatcgacaatgtgatcgtcggcctgcagaccgatgagccatgcaagcgagccatg
atgccgaatggcggttggcgcatggtggagcaggccatcaaggaggccggcaaggagccg
gacccggcgatcaagaagatcttcaccaagtaccgcaagacgcataacgacggtgtgttc
ggcgtctatacgaagaacatcaaagtggcacgccacaacaagattctcaccggcctgccg
gatgcctacggccgcggccgcatcatcggcgactaccgtcgtgtggccctgtatggcgtg
gatgcgctgattaagttcaagcagcgtgacaaggacgccatcccgtaccgcaacgacttc
tcggagaccgagatcgagcactggatccgttaccgcgaggagcacgacgagcagattaag
gctctgaagaagctcatcaacctaggcaaggaatacggactcgatttggcgcgccccgcc
atgaacgcgcgtgaggccgtgcagtggacctacatgggctacctcgcctccatcaagagc
caggacggcgccgcgatgagcttcggccgcgtgtcagcgttcttcgacatctacttcgag
cgcgatctcaaggaaggcaagatcaccgagaccgacgcccaggagatcatcgacaatctg
gtgatgaagctgcgcatcgtgcgattcctgcgcaccaaggactacgattcgatcttctcg
ggcgacccctactgggcgacatggtcggatgcaggcttcggcgacgatggccgcaccatg
gtcaccaagacgtcgttccgtctgctcaacacgctcacgctcgagcatttgggaccggga
cccgaaccgaacatcacgattttctgggatccgaagctgccggaaggctacaagcgtttc
tgcgcccagatctccattgatacctcggccatccagtatgaatccgacaaggagatccgc
aaccattggggtgacgatgcggccattgcatgctgcgtctccccgatgcgtgtgggcaag
caaatgcagttcttcgcggctcgcgtgaactccgccaaggcgctgctctacgcgatcaac
ggcggccgtgacgagatgaccggcatgcaggtgatcgacaagggcatcatcgagccgatc
cagcccgaggctgacggcacgctcgattacgagaaggtgaaggccaactatgagaaggcc
ctcgaatggctttcggagacctacgtcgaagcgctgaacatcattcattacatgcatgac
aagtatgcgtatgagtccatcgagatggcgctgcacgaccgcgaggtctaccgcaccctg
ggctgcggcatgtccggcctgtcgatcgccgccgattcgctttccgcatgcaagtacgcc
aaggtgtacccaatctacaacaaggacgccaaggacatgccgggtcacgagtacgaatat
gtcgaaggcgcggacgacgatctggtggtcggctaccgcaccgagggcgagttcccgctt
tacggcaacgacgacgatcgtgccgatgacattgccaagtgggtcgtgtccaccgtcatg
ggccaggtcaagcgcctgccggtgtatcgtggtgccgtccccacgcagtcgatcctcacg
atcacctcgaacgtcgagtatggcaagaacaccggatccttcccgtcgggccacgccaag
ggaacgccgtacgccccgggcgcgaacccggagaacggcatggactcccatggcatgctc
ccctcgatgttctcggtgggcaagatcgattacaacgacgcccttgacggcatctcgctg
acgaacacgatcacacccgacggcctgggccgcgatgaggacgaacgcatcagcaacctc
gtcggcatcctcgacgcaggcaacggccatggactgtaccatgcgaacatcaacgtgctg
cgcaaggaacagctcgaagacgccgtggagcacccggagaagtacccgcacctgaccgtg
cgcgtctccggttacgccgtgaacttcgtcaagcttacgaaggaacagcagcttgacgtc
atttcccgcaccttccatcagggcgcggtcgaggactaa

DBGET integrated database retrieval system