KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1239
Entry
Balac_1239        CDS       T00923                                 
Name
(GenBank) LacI-type transcriptional regulator
  KO
K02529  LacI family transcriptional regulator
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Brite
KEGG Orthology (KO) [BR:blc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:blc03000]
    Balac_1239
Transcription factors [BR:blc03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Balac_1239
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 TetR_N HTH_31 Activator-TraM
Other DBs
NCBI-ProteinID: ACS46595
Position
1430882..1431940
AA seq 352 aa
MTTMKEIAQAAGVSVSSVSLVLNGRDSGRINPQLANRIRETAERMGYQPNVLARSLRTNR
TYMIGFISVEVATTPYAGGMIQGAQDALSSLGYMLLTVNGDTEQALESEIRALKRYGVDG
FLYSAMSNRVMTVPKSLAKFPLVLVDAAEETNRFPSIEPDEFRIGYDATTRLIEAGCSRI
AYVGCAEPMVAQTGRLAGYRQALMDHGRGFDERLQCDVLNNGPALRAVEALFDTEQPNGF
FCFNDARAWYVYETAARHGLAVGRDISVVGVDNHRVFAETLEPQLTTIELPHYEMGYWAA
NKLVSMIENRPLNEGDWPHTTAVMPLLDTPSPVKVHCTLIEKGSVRDTPTTA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacgacgatgaaggaaatcgcacaagcggccggagtctccgtctcctcggtctcgctc
gtgctcaatgggcgtgattcggggcgcatcaatccgcagcttgcgaaccgcatacgcgaa
accgcagagcgaatggggtaccagcccaatgtgctggcccgctccctacgcaccaaccgg
acgtatatgatcgggttcatcagcgtcgaagtggccaccacgccatatgcgggcggtatg
atccaaggtgcacaggacgccttgagctcgcttggctacatgctcctcaccgtgaacgga
gacaccgaacaggccctggaaagcgagatccgcgctctgaaacgctacggtgtggatggc
ttcctgtattccgcgatgtcgaaccgcgtgatgacggtgcccaaatcactcgccaagttc
cctctggtgctcgtcgacgccgcagaggagaccaatcgcttcccgtccatcgaaccggac
gagttccgcatcggctatgacgccaccaccagactcatcgaagccggatgctcccgcata
gcgtatgtgggatgcgccgaacccatggtggcacagaccggcaggctcgccggttaccga
caggccctgatggaccacggcaggggcttcgacgaacgactgcaatgcgacgtgctcaac
aacgggccggcactacgtgccgtggaagcgttattcgacaccgagcagcccaacggattc
ttctgcttcaacgacgcacgcgcctggtatgtatacgagacggcggcacgacatggactg
gccgtcggacgcgacatctcggtggtcggcgtggacaaccatcgcgtatttgccgagaca
ctcgagccgcaactcaccaccatcgaactgccccactacgagatgggctactgggccgcg
aacaagctcgtgtcgatgatcgagaaccgcccgctcaatgaaggcgattggccccatacg
accgcggtgatgcctctgcttgacacgccatcgccggtgaaggtgcactgcacgctgatc
gagaagggatcggtgcgcgacacgccgacgaccgcgtga

DBGET integrated database retrieval system