KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_0095Help
Entry
Balac_0095        CDS       T00923                                 

Definition
(GenBank) methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Brite
KEGG Orthology (KO) [BR:blc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:blc03009]
    Balac_0095
Enzymes [BR:blc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Balac_0095
Ribosome biogenesis [BR:blc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Balac_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS Ubie_methyltran Methyltransf_2 Methyltransf_4 Methyltransf_23 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ACS45491
Position
109132..110085
Genome map
AA seq 317 aa AA seqDB search
MSPEKLARFADSWKYFVCPLCREELRLEGTSLRCERGHTYDVARQGYVNLAPGARQSEYY
SRESFEHRGQILSAGYYSHIVDAVLSAVGRYCGQIAASIDFAGLRTRSGAQLRGARGRAD
LRSSGPQMRAPVILDVGCGEGFYARAVQAAHPDATVLAFDISKDSVQLAAREDAGCAVRW
FVGNLAELPVRDGAVDCVLDVFSPVNYAEFTRVLGGSGVVIKVVPGARHDEQLRELARGQ
LRHGDYSNEQVVGQFAEHFDVLERRLVSQTFPMPADDVLAFARMTPLLFNVDVDSLDLSR
IHELTVEAEILVGSVCG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggagaaattggcgcggtttgcggattcctggaaatacttcgtgtgcccgctg
tgccgtgaggagctgcggctggagggtacgagtctgcgttgcgaacgcggtcacacctac
gacgtggcgcggcaggggtacgtgaatctggcgcccggtgcgcggcagtcggaatattac
agcagagagtcgttcgagcaccgcgggcagattctctccgccggctattactcgcatatc
gtcgacgccgtgctgagtgccgtggggcggtattgcgggcagattgccgcgtccatcgat
ttcgcgggcctgcgcacgcgttccggcgcgcaattgcgcggcgcacgcgggcgtgcggat
ctgcgctcgagcgggccgcagatgcgcgcgccggtgatactcgacgtcggctgcggcgaa
ggattctatgcgcgcgccgtgcaggcggcgcatccggatgccacggtgctcgcgttcgac
atctccaaggattccgtgcagctggcggcgcgcgaagacgcggggtgcgcggtgaggtgg
tttgtggggaatctggccgaactaccggtgcgtgacggcgccgtggactgcgtgctcgac
gtgttctcgccggtcaactacgcggaattcacgcgcgtgctcggcggctcgggcgtggtg
atcaaggtggtgcccggcgcgcggcatgacgagcagctgcgcgagctcgcacgcggccag
ctgcgccacggcgactattcgaacgagcaggttgtggggcagttcgccgagcatttcgat
gtgctggaacgccggctcgtctcccagaccttcccgatgccggccgacgatgtgctcgcc
ttcgcccgcatgacgccgttgctgttcaacgtggacgtggattcgcttgatctctcccgg
attcatgagctcaccgtggaggcggagatcctcgtgggcagcgtgtgcgggtga

DBGET integrated database retrieval system