KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1017Help
Entry
Balac_1017        CDS       T00923                                 

Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
blc00010  Glycolysis / Gluconeogenesis
blc00680  Methane metabolism
blc01100  Metabolic pathways
blc01110  Biosynthesis of secondary metabolites
blc01120  Microbial metabolism in diverse environments
blc01130  Biosynthesis of antibiotics
blc01200  Carbon metabolism
blc01230  Biosynthesis of amino acids
blc03018  RNA degradation
Module
blc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balac_1017
  Energy metabolism
   00680 Methane metabolism
    Balac_1017
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Balac_1017
Enzymes [BR:blc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Balac_1017
Messenger RNA biogenesis [BR:blc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Balac_1017
Exosome [BR:blc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Balac_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: ACS46375
Position
complement(1161570..1162862)
Genome map
AA seq 430 aa AA seqDB search
MAAIESVYARQILDSRGNPTVEVVLDTDDGARGLGLVPSGASTGEAEAWERRDGDKSVYQ
GKGVLGAVKAVNEEIAPKVIGMDATDQRALDDLMIELDGTPNKGRLGANAILGVSLAALY
AAAESAELPLYRYIGGTNGHVLPVPNMNIMNGGAHADFATDIQEYMISPYGFQTYSEALQ
AGVEVYHTLKNVLKKQGLATGLGDEGGFAPKMKTNEDSLKYIMDAISAAGYEPGKQIGIA
LDVASSEFYNKETGKYHFDGEDRDSEYMLDFYEKLVDQFPIVSIEDPFQEEGWEDWAKIT
KALGDRLQFVGDDLFVTNPVRLKKGIDMGAGNSLLVKLNQIGTVSETLDAIELATKNGFT
SMVSHRSGETPDTTISDLAVAKNTGQIKTGAPARGERIAKYNRLLEIEEELGSTAEYAGY
SAFKACRKYM
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcaattgaaagcgtgtacgcacgccagattcttgattcccgcggcaacccgacc
gttgaggtcgtgctcgacaccgatgacggtgctcgcggcctgggtctcgttccctccggc
gcctccaccggcgaagccgaggcttgggagcgtcgcgatggcgacaagtccgtctatcag
ggcaagggtgtcctcggtgccgtcaaggcggtgaacgaggagatcgccccgaaggtcatc
ggcatggacgccaccgaccagcgcgcactcgatgacctgatgatcgagctcgacggcacc
ccgaacaagggccgtctgggcgccaacgccatcctcggtgtctccctcgccgccctttat
gcggccgccgagagcgccgaactgccgctgtaccgctatatcggcggcaccaacggccat
gttctcccggttccgaacatgaacatcatgaacggcggcgcacacgctgacttcgccacc
gacatccaggagtacatgatctccccgtacggcttccagacctactccgaggctctgcag
gccggcgtcgaggtgtaccacaccctcaagaacgtgctgaagaagcagggtctggccacc
ggtctcggcgatgagggcggcttcgctccgaagatgaagaccaacgaggattccctcaag
tacatcatggacgccatctccgccgccggctatgagccgggcaagcagatcggcatcgcc
ctcgatgtcgcctcctccgagttctacaacaaggagaccggcaagtaccacttcgatggt
gaggaccgtgattccgagtacatgctcgacttctacgagaagctcgtcgaccagttcccg
atcgtctccatcgaggatccgttccaggaggaaggctgggaagactgggccaagatcacc
aaggcccttggcgaccgcctgcagttcgtcggcgacgatctgttcgtcaccaacccggtg
cgtctgaagaagggcatcgatatgggcgccggcaactccctgctggtcaagctcaaccag
attggcaccgtttccgagaccctcgacgccatcgagctggccacgaagaacggcttcacc
tccatggtctcccatcgttcgggcgagacgccggacaccacgatctccgatctcgccgtc
gccaagaacaccggccagatcaagaccggcgccccggcacgtggcgagcgcatcgccaag
tacaaccgcctgctcgagattgaggaagagctcggttcgaccgccgaatacgctggctac
agcgcattcaaggcatgccggaagtacatgtga

DBGET integrated database retrieval system