KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1054Help
Entry
Balac_1054        CDS       T00923                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
blc00330  Arginine and proline metabolism
blc01100  Metabolic pathways
blc01110  Biosynthesis of secondary metabolites
blc01130  Biosynthesis of antibiotics
blc01230  Biosynthesis of amino acids
Module
blc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:blc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Balac_1054
Enzymes [BR:blc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Balac_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Sacchrp_dh_NADP Rossmann-like ApbA IlvN 2-Hacid_dh_C GFO_IDH_MocA NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ACS46412
Position
complement(1206609..1207403)
Genome map
AA seq 264 aa AA seqDB search
MKVGFIGYGNMAQAIAQGLTRAHAVDGNDIVACAAHFDKLERNIAAVGGTAMHTPQEVVA
AADMVVVAIKPYQVEDVLAPMAGALADDSKMLVSLAAGWDLARYQTLFGGAATGIHIQCT
IPNTPMAVAQGVLICENVNTLTPSQCQGFVDLFSRISLIEEVDTAHMGIAMCIAGCAPAF
TDMYLEALGDAGVKYGLQRATAYRLAAKMIEGVGALCLDSGVHPGAMKDAVCSPGGTTIK
GVAELENRAFRGAVISAVDAIEQG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttggtttcattggctacggcaacatggcacaggcaatcgcacagggattgacc
cgtgcgcatgcggtcgacgggaacgacattgtggcatgcgccgcgcatttcgacaagttg
gaacgcaacatcgcggcagtgggcggcactgccatgcacaccccgcaggaggtcgtcgcg
gccgccgacatggtggtcgtggcaatcaaaccatatcaggtcgaggatgtacttgctcca
atggccggagcactcgccgacgattcgaagatgctcgtatcgcttgccgcaggctgggat
ctggcgagataccagaccctgttcggtggggcggccaccggcatccacatccagtgcacg
attccgaacactccgatggccgtggcccagggggtgctgatctgtgagaacgtgaacacc
ctcaccccgagccaatgccagggattcgtcgacctgttctcccgtatatcgctcatcgag
gaggtcgataccgcgcatatggggattgcgatgtgcatcgccggttgtgccccggcgttc
accgacatgtacttggaggcgctcggcgacgccggcgtcaagtacggtctgcagcgtgcg
accgcatatcgtttggccgcgaagatgattgaaggtgtcggtgccctgtgcctcgactcg
ggagttcacccgggtgccatgaaagatgcggtgtgttcgcctggcggcaccaccatcaag
ggtgtcgccgaactcgagaaccgtgcgttccgtggtgcggttatcagtgcggtcgatgcc
atcgagcagggctga

DBGET integrated database retrieval system