KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00051Help
Entry
BLi00051          CDS       T00200                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA ligase MetS
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00450  Selenocompound metabolism
bld00970  Aminoacyl-tRNA biosynthesis
bld01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BLi00051 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLi00051 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bld01007]
    BLi00051 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bld03016]
    BLi00051 (metS)
Enzymes [BR:bld01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BLi00051 (metS)
Amino acid related enzymes [BR:bld01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BLi00051 (metS)
Transfer RNA biogenesis [BR:bld03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BLi00051 (metS)
 Prokaryotic type
   Other AARSs
    BLi00051 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: AAU39031
Position
49915..51903
Genome map
AA seq 662 aa AA seqDB search
MPQEKNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIQ
QTAEKENITPQELVDRAAEDIQQLWKKLDISNDDFIRTTEERHKKVIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDVERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKY
ADRLLAFYEENPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVIYVW
IDALFNYITALGFNTENDENYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVF
AHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMVNKYFDGRIQSYEGPVTAFDEPLSSFSQKTIEAYEQAIENMEF
SVALSSLWQFVSRTNKYIDETAPWVLAKDKDKEKELQSVMYHLAESLRITAVLLQPFLTQ
TPEKIFAQLGVTDASLKTWDSIQSFGQLKSVTVQKGEPLFPRLEAEDEVAYIKSKMQGTA
PKEEPKQEEKAHERLPEITIDDFMSTELRVAEVIHAEPVKKADRLLKLQLDLGFEKRQVV
SGIAKHYKPEELVGRKVICVTNLKPVKLRGELSQGMILAGEDNGVLSLAAVDSSLANGTR
IK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagaaaaaaatacgttttacatcactacacccatttattacccaagtgggaag
ctacatattggacatgcctacacgaccgttgcaggtgatgcgatggctcgttataaaaga
ctgagaggctttgatgtcagatacttaactggtacagatgagcacggacaaaaaattcag
caaacggcggagaaggaaaacatcactccgcaggaattggtcgatcgtgcggcagaagac
attcagcagctttggaaaaagctcgacatatccaatgacgacttcattcggacgacagag
gaacgtcataaaaaagtgatcgaaaaggtatttcagaagctgcttgacaatggtgacata
tatcttgatgaatatgagggctggtacagcatccctgacgaaacgttttacaccgaaacc
cagctcgttgatgtcgagcgaaacgagaaaggcgaagttatcggagggaaaagtcctgac
agcggccaccccgttgagctaatcaaagaggaatcttacttcttccgcatgggaaaatac
gcggatcggcttctcgctttctatgaagaaaatcctgaattcatccagcctgaatcccgg
aaaaatgaaatgatcaacaactttatcaaaccgggtcttgaagatttggctgtttcccgg
acgacgttcgactgggggataaaagtgcccggcaatccgaagcatgtcatctatgtttgg
atagatgcgctgtttaattacattacggcacttggctttaatacggaaaacgatgaaaat
tatcaaaaatattggccggcagacgttcatcttgtcggtaaggagatcgtccgcttccat
accatttactggccgattatgctgatggcattggaccttccgctgccgaaaaaggttttt
gcccacgggtggctgctgatgaaagatggaaaaatgtctaaatcaaaaggcaatgtggtt
gacccggtcacattaatcgacagatacggactagatgcattgcgttattatcttctccgc
gaagtgccgttcggttctgacggcgtatttacaccggaaggatttgtcgagcggattaac
tatgatttagcgaatgatttaggcaacctgctgaacagaacggtcgccatggtcaacaaa
tactttgacggccggattcagtcgtatgaaggcccggttaccgcttttgacgaaccgttg
tcatcattctcgcaaaagacaattgaagcgtacgagcaggcgatcgaaaatatggagttt
tccgttgcgctttcatcattgtggcagtttgtcagcagaacgaataaatacatcgacgag
acagccccttgggtactggcaaaagataaggataaagaaaaagagcttcaatcggtcatg
taccatttggcggagtcattgcgcatcactgctgtattgctgcagccgttcttaacgcag
acgcctgaaaagattttcgcacagcttggcgttacggatgcgtcactgaaaacctgggac
agcattcaaagcttcggccagctgaaatctgtgacagttcaaaaaggagaaccattgttc
ccgcgtcttgaggcggaagacgaagtcgcttatatcaaatcaaaaatgcagggaacggct
ccaaaagaagaaccaaagcaagaggaaaaagcacatgaacggcttccggaaatcacgata
gacgattttatgagcacagagctcagagtggctgaagtcattcatgctgaacccgtcaaa
aaagcggatcgtctgttaaaactccagcttgatttaggctttgaaaaacgccaagtcgtt
tcaggaattgccaagcactacaaacctgaagagcttgtcggccggaaagtcatttgtgta
acaaatttaaaaccggtcaaactaagaggagaactttctcaaggcatgatattggctgga
gaggacaacggcgttctctcgcttgcggcggtagacagttcattagcaaacggaacgcga
atcaaataa

DBGET integrated database retrieval system