KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00138Help
Entry
BLi00138          CDS       T00200                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bld00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BLi00138 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bld03011]
    BLi00138 (rplV)
Ribosome [BR:bld03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BLi00138 (rplV)
  Bacteria
    BLi00138 (rplV)
  Archaea
    BLi00138 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AAU39112
UniProt: Q65PA2
Position
136413..136757
Genome map
AA seq 114 aa AA seqDB search
MQQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNHTPKAASPIIEKVLKSAIANAE
HNYEMDANNLVVTQAYVNEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagctaaagctgtcgcaagaacagtccgtattgctcctcgtaaggcacgtcta
gtaatggacctgattcgaggcaagcaagtaggtgaagcagtatcgatcttaaaccatacg
ccaaaagctgcttccccgattattgaaaaagttttaaaatctgctatcgccaacgctgag
cacaactacgaaatggatgcaaacaacctggttgttactcaagcttacgtgaacgaaggc
cctacgttaaaaagattccgtccgcgcgctatgggacgtgcaagccaaatcaacaaacgt
acgagccacattactatcgttgtatcagaaaagaaggagggataa

DBGET integrated database retrieval system