KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01156Help
Entry
BLi01156          CDS       T00200                                 

Gene name
addB
Definition
(GenBank) ATP-dependent helicase/deoxyribonuclease beta subunit AddB
  KO
K16899  ATP-dependent helicase/nuclease subunit B [EC:3.1.-.- 3.6.4.12]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Brite
KEGG Orthology (KO) [BR:bld00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bld03400]
    BLi01156 (addB)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BLi01156 (addB)
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BLi01156 (addB)
DNA repair and recombination proteins [BR:bld03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    AddAB pathway proteins
     BLi01156 (addB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDDEXK_1 Exonuc_V_gamma UvrD_C AAA_16 Dpoe2NT
Motif
Other DBs
NCBI-ProteinID: AAU40064
UniProt: Q65LK0
Position
1160967..1164467
Genome map
AA seq 1166 aa AA seqDB search
MGAVFLSGRSGSGKTTFILNEIREKLRDEPLGKPIIFLVPDQMTFLMEYELSKTPDLGGT
IRAQVYSFSRLAWRVLQHTGGMNRPFLTGTGIQMLLRRLIEEHKGEFKVYQNASDKSGFT
EQVERMLTEFKRHCLPPQSIRDMMEGTGKSEYEDERILSDKLHDLYILYSKLEENLENQY
VQSEDYLTLLAEQIPYAEEIRNAAVYVDGFHQFTPQEMSVLEQLMVHAEEITFSLTADKP
FTANSPNDLHLFRMTGKAYYDLYQKAKELGLDPSEVRLEETKRHRHHPELQHLERYFDER
PAKPYPGQTESLRIMQASNRRTEIEGIAREIHSLIRQGRFRLRDIAVIARNVEDYKDTIK
EVFKDCELPFFIDGKESMQNHPLIELIRSTLDIIKGNWRYEAVFRCVKTELLFPEGQPKE
RLREQIDQLENYCIAYGIKGDRWTSKDPFVYRRYASLDEDFAKTDKEIETENMLNELKGW
IVPPIHRLQKRLKKAETVREMAEAVYLYLEEADVPMKLEQERRLAEEGGRIAESRQHEQV
WDAVIQLLDEFVEMMGTERISFALFQQMIETGLESLKFALIPPALDQVFIGNMDLSRMYG
TKCTFLIGVNDGILPARPADDGVLSDEDREWLKRNGAQLAATGREQLLDENFLIYMTLSS
PSEKLYVSYPIADSEGKTLLPSTVVKRLNELFPDSEEKMLIHEPEQLDDEAQLEFLVNKG
IALSHLAGQLGIWTRQYAISDVWWSTYNFLMNEPDRIFSQNILSSLFFRNKVENLNRHVS
RDLYGEHIQGSVSRMETFKACPFSHFASHGLKLKERQFFKLEAPDIGQLFHSALKLISDR
LHELKLDWRDLTKAQCETLSSDAVERLAPKLQKEILLSSNRHHYVKQKLQKIIARVSGIL
SEHAKASGFAPVGIELGFGGKGPLPPMRFTLKNGCTMELVGRIDRVDKAESSKGLLLRIV
DYKSSDKGLDLAEVYYGLALQMLTYLDLSITHSTDWLGMKASPAGVLYFHVHDPMIQASV
PLGLDEIEKEIFKKFKMKGLLLGDQEAVKLMDTTLEQGRSNIISAGLKKDGSLRSDSDVV
AEEDFHVLRRHIRRTFQQAGEEITDGKVSIEPYKLKDRTPCTYCSYRSFCQFDESLEENE
YRILKPEKDSVILERLKKEDEADGDF
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
gtgggagcagtatttttatcaggcagatccgggagtgggaaaacgacctttatcctgaat
gaaatcagagaaaaacttcgcgatgaaccgctcggaaaaccgatcatttttctagtcccg
gatcaaatgacgtttttaatggaatacgagcttagcaaaacaccagatttgggcggcacc
atccgcgcccaagtgtacagtttttcacggcttgcctggcgagtgctccaacacaccgga
ggcatgaaccggccgttcttgacgggaacgggcattcagatgctgctgcggagactgatt
gaagagcataagggcgagtttaaagtctatcaaaacgcaagcgataaaagcggatttacg
gagcaggtggaacggatgctgaccgaatttaaacggcactgtctgccgcctcaaagcatc
cgggatatgatggaagggacaggcaagtcggaatacgaagatgaacggattctttccgat
aaattgcacgacttatatattttgtacagcaagcttgaggaaaatctggagaatcaatat
gttcaatctgaagattatttgacccttttagccgaacagattccgtatgcggaagagatt
agaaacgctgccgtttacgttgacggatttcaccaattcacgcctcaggagatgagcgta
ctagaacagctgatggtacatgccgaagagatcacgttttcgctgacggcggataagccg
tttacggcaaacagcccgaatgatctccatctgttcaggatgaccgggaaggcgtactat
gacctttaccaaaaggcgaaggaactcggccttgatccgtctgaagtgcggctggaagaa
acgaaacggcaccggcatcatccggagcttcagcatcttgaacgctattttgatgaacgt
cctgcaaaaccgtatcccggacagacggaatcgctccgcatcatgcaggcgtcgaacaga
agaaccgagattgaaggaattgcgcgcgagattcattctttaatccgccagggccggttc
cggcttagggatattgctgtcatcgcccgcaatgttgaagattataaagatacgataaaa
gaagtttttaaagactgcgaacttccttttttcatagacggcaaggaatcgatgcaaaat
catccgcttattgagctgatccgttcgacgcttgatatcattaaaggaaattggcggtat
gaagccgtgttccgctgtgtcaaaacggagcttttattcccggaaggacagccgaaggaa
cggctgcgcgaacagattgaccagcttgaaaactactgtattgcttatggcattaaagga
gacagatggacaagcaaagatccgtttgtttacagaagatacgcttcactggatgaggat
tttgccaagacagacaaagagattgaaacggaaaatatgctcaatgaactaaagggctgg
atcgttccgccgattcacaggctgcagaagcgcttgaaaaaagctgaaacagtaagggaa
atggccgaagccgtctacctttatcttgaagaagccgatgttccgatgaagcttgaacag
gaaaggcggctagccgaagaaggcggaaggattgccgagtcgcgccagcatgagcaagta
tgggatgccgttattcaactgttggacgagtttgttgaaatgatgggcacagagcggatt
tcgtttgcgttatttcagcaaatgatcgaaaccggattggagtctttgaaattcgcgctg
attccgcccgcacttgatcaagtgtttatcggcaatatggacctttcaaggatgtacggc
acgaaatgtacatttctcatcggtgtaaacgacggcatacttccggcgaggcctgcggat
gacggcgtgctttcagacgaggacagggagtggctgaaacgaaacggcgcacagctggcg
gcaacagggcgagagcagctattggacgagaattttctgatctatatgacgctttcaagc
ccgtctgaaaagctttatgtctcctatccgatcgctgattcggaagggaagacgctgctt
ccttcaacagtggtgaaacggctgaatgaactgttcccggacagcgaagaaaagatgctg
attcatgaacccgagcagctggacgatgaagcccagcttgaatttctcgtgaataaaggc
atcgccttgagccatttggcagggcagctcggcatctggacgaggcagtatgcgatcagc
gatgtatggtggagtacatacaactttttaatgaatgagcctgaccgcatcttttctcaa
aacatcctgtccagcctgtttttcagaaacaaggtcgaaaacctaaaccggcatgtgagc
cgcgatttatacggggagcacattcagggaagcgtgtcgcggatggagacgttcaaggcc
tgtccgttttcccattttgcttcgcacggcttaaagctgaaggaacgccaatttttcaag
cttgaagctccggatatcggtcagctgttccactctgcgctgaagctgatttcagaccgg
cttcacgagcttaaactggattggcgcgacttaacgaaagcccagtgcgagactttgtca
agcgatgcagttgaacggcttgcgcctaaactgcaaaaggagattctgctcagttcgaac
cgtcatcattatgtgaagcagaagctgcaaaaaatcattgccagggtatcgggcatttta
agtgagcatgcaaaagcaagcggctttgcccccgtcggcatagagctcggattcggaggg
aaaggtccgcttcctccaatgcgtttcaccttgaagaacggttgcacgatggagcttgtc
ggccggatcgacagagtggataaagcggagagctcaaaagggttgctgcttaggattgtt
gattataaatcaagcgataaaggcctcgatttggccgaggtgtattacgggcttgccctg
caaatgctgacatatctcgatttgtcgatcacgcattcaaccgattggctcggcatgaaa
gcatccccggcaggcgtgctctattttcatgtgcacgatccaatgatccaggcttcagtg
ccgctcggccttgatgaaatagaaaaagagattttcaaaaagttcaagatgaaagggctg
ctcctgggagaccaggaagcggtcaagctgatggacaccaccctggaacaaggcaggtcg
aatattatcagcgccggtttgaaaaaagacggctcgctccgttcggattctgacgttgtt
gcagaagaggattttcatgtattgaggcgtcatatccgccggacatttcagcaggccggc
gaggagatcacagacggcaaagtgtcgatcgagccttacaagctaaaagaccggacaccg
tgcacatattgttcataccggtcattctgccagtttgacgaatcgcttgaggaaaacgaa
taccgaatattaaaacctgaaaaagacagcgtgatattggagcggctgaaaaaggaggat
gaggcagatggagatttctaa

DBGET integrated database retrieval system