KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi04178
Entry
BLi04178          CDS       T00200                                 
Symbol
sacA2
Name
(GenBank) sucrose-6-phosphate hydrolase SacA
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00052  Galactose metabolism
bld00500  Starch and sucrose metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BLi04178 (sacA2)
   00500 Starch and sucrose metabolism
    BLi04178 (sacA2)
Enzymes [BR:bld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BLi04178 (sacA2)
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Other DBs
NCBI-ProteinID: AAU42991
Position
complement(4005463..4006941)
AA seq 492 aa
MNRIQQAEEALKKAGKKVNRRYRMGYHMMPRANWINDPNGLIQYKGEYHVFYQHHPYDEN
WGPMHWGHLKSKDLIHWEHLPVALAPGDEFDESGCFSGSAVEYNGDLALIYTGHNMIDEE
KDDFYQTQNIAVSKDGIVFEKLKENPVIAEPPEDSARHFRDPKVWKHRENWYMVVGNSSK
ENVGRVILYRSPNFVDWEYVGVLAQSDGNLGFMWECPDFFELDGKHILLISPQGIEADGE
SYQNLYQTGYLIGDYDEETNEFVHGSFKELDHGHDFYAVQTLLDDKGRRIAIGWMDMWES
EMPTKADGWCGALTLPRELTLKDGHKILMNPVEETKLLRGSEHHECDNQSISGSYFIKTA
EKLLEVVAVFDLTICSAETVGLKIRGIEQEETTIKYSLIDQKLTLDCSKSGKARDGVRNV
RLEADEKLTLHLFLDRSSIEVFANHGEATMTSRIYPKEGRAGIELFSEKGNVRVEEFTYW
TLKDIWKGDEAK
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaacagaattcagcaggcagaagaagcattaaagaaagccgggaaaaaagtgaatcgc
cgttaccgaatgggctatcacatgatgccccgggcaaactggataaatgatccaaacgga
cttattcaatataaaggggagtatcatgtcttttatcaacatcatccgtatgatgagaat
tgggggccgatgcattggggccatttgaagagcaaggatcttattcactgggagcacttg
ccggttgctttagcgccgggagacgaatttgatgagagcggctgtttctcaggaagcgca
gtcgaatataacggcgacctcgctttaatctatactgggcataatatgatagatgaagag
aaagacgatttctaccaaactcagaatatagcagtcagcaaagacggtatcgtctttgaa
aaactgaaagaaaaccctgttattgcagagccgccggaagacagcgcacgtcactttcgc
gatccaaaagtatggaagcatcgtgagaactggtatatggtggtcggaaactcctcaaaa
gagaacgtcgggcgggtcatcttataccgctcgcctaactttgtagattgggagtacgta
ggcgttctcgcccaaagcgacggaaatctcggctttatgtgggaatgtccggatttcttt
gaactagacggcaaacacattttgctgatttcccctcagggtatagaggctgatggtgaa
tcatatcaaaatctgtatcaaacaggctatttgattggagactatgatgaagaaacgaat
gagtttgtacatggctcctttaaagagttggatcacggccacgacttttatgccgtgcaa
actttattggatgacaaaggccgcagaattgcgattggctggatggatatgtgggagtca
gagatgccgacgaaagcagacggatggtgcggggcattaactttgccgcgtgaattgacg
ttgaaggatggtcacaaaattttaatgaatcccgtcgaggagactaaattacttcgtgga
tcggaacatcatgagtgtgacaatcaatcgatttccggcagctattttataaagacagcc
gaaaagcttcttgaagtggtggccgtttttgatttgacaatttgcagtgccgaaacggtt
ggcttaaagatccggggaattgaacaggaagaaacaaccatcaagtacagcttgattgat
caaaagctgacgctcgactgttcaaagtccggcaaagcgagggacggtgtgagaaacgta
cggcttgaagcggatgagaagctcactttgcatctgtttctcgacagatcgtctattgaa
gtatttgcaaatcatggtgaagcgacaatgacaagccgcatatatccgaaggaaggaaga
gcggggattgagctgttttctgagaaaggcaacgtacgggttgaagaattcacttactgg
acgttgaaagatatttggaaaggtgatgaagccaaatga

DBGET integrated database retrieval system