KEGG   Bacillus lehensis: BleG1_1901Help
Entry
BleG1_1901        CDS       T03204                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ble  Bacillus lehensis
Pathway
ble00071  Fatty acid degradation
ble00072  Synthesis and degradation of ketone bodies
ble00280  Valine, leucine and isoleucine degradation
ble00310  Lysine degradation
ble00362  Benzoate degradation
ble00380  Tryptophan metabolism
ble00620  Pyruvate metabolism
ble00630  Glyoxylate and dicarboxylate metabolism
ble00640  Propanoate metabolism
ble00650  Butanoate metabolism
ble00900  Terpenoid backbone biosynthesis
ble01100  Metabolic pathways
ble01110  Biosynthesis of secondary metabolites
ble01120  Microbial metabolism in diverse environments
ble01130  Biosynthesis of antibiotics
ble01200  Carbon metabolism
ble01212  Fatty acid metabolism
ble02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ble00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BleG1_1901
   00630 Glyoxylate and dicarboxylate metabolism
    BleG1_1901
   00640 Propanoate metabolism
    BleG1_1901
   00650 Butanoate metabolism
    BleG1_1901
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BleG1_1901
   00072 Synthesis and degradation of ketone bodies
    BleG1_1901
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BleG1_1901
   00310 Lysine degradation
    BleG1_1901
   00380 Tryptophan metabolism
    BleG1_1901
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BleG1_1901
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BleG1_1901
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BleG1_1901
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ble04147]
    BleG1_1901
Enzymes [BR:ble01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BleG1_1901
Exosome [BR:ble04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BleG1_1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C DegV
Motif
Other DBs
NCBI-ProteinID: AIC94479
UniProt: A0A060M327
Position
complement(1865549..1866688)
Genome map
AA seq 379 aa AA seqDB search
MTRVAVTGIGMTPFGKSNDSLKALLLKASRQALIDAGRPKIDAIIVGNFMGGPLEQQEIL
GSILVSELGFGNIPSMKTEGACASGGIAFRQAYQLLKAEEYKTVLVVGGEKMTHIHTNHV
ITAINYAMDNSTMESKTGLTFPGYFGVVANRYMYQYGATKAHLAMVARKNRHYALHNPLS
QFNTKITLEEIMNARMITDPLGLFDCSPITDGAAAVVIEGNTKNGVEVIASGQASGTPIM
QEVNDLTRIPATYEAATQAYEQASIEPKDVDVVELHDCFSMTEIIAIEELGFFEKGTGFE
AIEKQLTEHGGNIPVNTSGGLLSKGHPIGATGIAQIVQIISQLRGEACNQVERARIGLAQ
NLGGTGAYSLVHLFKKEGA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtgttgctgtaaccggtataggaatgacgccgtttgggaaaagcaatgactca
ttgaaagccttgcttttaaaagcatctcgccaagcgttaattgatgcaggtaggccaaag
attgacgccattattgttggtaactttatgggaggacctttagaacagcaagaaatttta
ggaagcatccttgtatctgaattaggtttcggaaatattccttccatgaaaacagaagga
gcatgcgcttcaggtggaatcgcgtttcgtcaagcctatcaattactaaaagcagaagag
tacaaaacggtccttgttgttggtggagagaaaatgactcatattcatacgaatcatgtc
atcacagcgattaattatgcaatggataatagcacaatggagtcaaaaacgggattaacg
tttccgggttatttcggtgtcgtagccaatcgctatatgtatcaatacggagcaacaaaa
gcgcacttagccatggttgcgcgcaaaaacagacattatgcactgcataatccgctttcg
caatttaatacgaagataacattagaagaaattatgaatgctcgaatgattacagatcct
cttggtttatttgactgctccccaataacagatggggctgcagctgtagtcattgagggt
aatacgaaaaacggagttgaggtcattgcttcaggtcaagcatcaggcacacccataatg
caagaagtgaacgacctaacacggataccagctacgtatgaggcagcaacacaagcatat
gaacaagcatcgattgaaccgaaagatgtagatgtggttgaattgcacgattgcttttca
atgactgagattatcgcaatcgaagaacttggtttttttgagaaaggtacagggtttgaa
gcaattgaaaagcaactaaccgaacatggagggaacattcctgtaaatacaagcggtggc
ttactgtctaaaggtcatcctatcggagcaacgggtattgctcaaattgtgcaaattata
agccaattaaggggggaagcttgcaatcaagtggaacgagcgcggattggtttagcacaa
aatttaggtggtacaggtgcttattcactcgttcatctctttaaaaaggaaggtgcataa

DBGET integrated database retrieval system