KEGG   Bacillus lehensis: BleG1_3940Help
Entry
BleG1_3940        CDS       T03204                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ble  Bacillus lehensis
Pathway
ble00020  Citrate cycle (TCA cycle)
ble00620  Pyruvate metabolism
ble01100  Metabolic pathways
ble01110  Biosynthesis of secondary metabolites
ble01120  Microbial metabolism in diverse environments
ble01130  Biosynthesis of antibiotics
ble01200  Carbon metabolism
Module
ble_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ble_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ble00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BleG1_3940
   00620 Pyruvate metabolism
    BleG1_3940
Enzymes [BR:ble01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BleG1_3940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase HI0933_like Pyr_redox Pyr_redox_2 Thi4 MCRA
Motif
Other DBs
NCBI-ProteinID: AIC96487
UniProt: A0A060M203
Position
complement(3819305..3820822)
Genome map
AA seq 505 aa AA seqDB search
MSYRETKSDVILIGAGVMSATLGTLLKELAPDWKVTVFEKLKSAGEESSNEWNNAGTGHA
ALCELNYTSEKPDGSLDISKAVKVNEHFQLSRQFWSYLVRKKLIENPKEFIMPIPHISMV
QGEKNGLFLKKRMEALSDNPLFEGMSFSDDPDVLKEWMPLVMEGREEGDGPVAATKIDTG
TDVNFGSLTRKLFTHLENENVAVHYEHSVKDLKKAADGSWKVKVQNINTGETENHSAKFV
FIGAGGGSLPLLQKTGIPESRRIGGFPVSGLFLVCNNPEIVEQHHAKVYGKAKVGAPPMS
VPHLDTRYIDNKKSLLFGPFAGFSPKFLKTGSYFDLIGSVKPNNLFTMLGAGFKELGLTR
YLIQQVMLSNEKRMEELKEFIPNAKSEDWEIIVAGQRVQVIKDTEAGGRGTLQFGTEVVT
ADDGSVAALLGASPGASTAVHVMLEILEKCFPTEIDGWKTKIKEMVPSYGKLLMSHPSLF
KEIQASTARDLQLEESYVPSQEHLA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagctatagagaaactaagtcagacgttattttaattggcgctggagtgatgagcgcg
acgctaggtacgttattaaaagagttagcaccagactggaaagtgacggttttcgaaaag
ttaaaaagtgcaggggaagaaagctcaaatgaatggaataacgctggtacaggtcatgca
gcactgtgcgaattaaactatacgtctgaaaagccggacggatcacttgatataagtaag
gctgtaaaggttaatgagcattttcaactctcacgacaattttggtcctatcttgtaaga
aaaaagctaattgaaaatcctaaagaatttattatgccaattccacatattagtatggtt
caaggtgaaaagaatggcttatttttaaaaaagcgtatggaagcgttatcagacaaccct
ctttttgaaggaatgtcgtttagtgatgaccctgatgtgttaaaagaatggatgcctctt
gtaatggaaggtcgagaagaaggcgatggacctgttgcggcaacgaaaattgacacaggt
acagatgtgaattttggctcactaacacgtaagttatttacccatttagaaaatgagaac
gtcgctgttcattatgagcatagtgtaaaagatttgaagaaagcagccgatggttcttgg
aaagtaaaagttcaaaatatcaatacgggagaaacggaaaatcattcagctaaattcgtc
tttattggtgctggtggaggtagtttaccgttactacagaagacaggaatacctgaatca
cgtcgaattggaggatttcctgtaagcggattatttctagtctgtaacaatcccgaaata
gtagagcagcatcatgcgaaagtatatggtaaagcaaaagtaggagctcctccaatgtcg
gttccgcatttagatacgcgttatattgataataagaaatcgttattgtttggtccgttt
gctggattttctcctaaatttcttaagaccggctcatactttgatttgattggttctgtt
aagcctaataatctctttaccatgctaggagcaggctttaaagaattagggttaacccgc
tatttaattcaacaagttatgttatcaaatgagaagcgaatggaagaattaaaggaattt
attccgaatgcgaaaagtgaagactgggaaatcatcgttgctggtcagcgtgtgcaggtt
attaaagatacagaagcaggcggaaggggaacacttcagttcggaacggaagtcgtcaca
gcagatgatggttctgttgccgcattacttggtgcttcaccaggtgcatcgacagcagtc
catgtaatgcttgaaattttagagaaatgtttcccgacagaaatagatggatggaaaaca
aaaattaaagagatggttccttcctatggaaaattattaatgagccacccaagtttattt
aaagaaattcaagcatcgacagctcgagatttacagctagaagagtcatacgtaccgtct
caagagcatttagcttaa

DBGET integrated database retrieval system