KEGG   Beggiatoa leptomitiformis: AL038_00880Help
Entry
AL038_00880       CDS       T04090                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
blep  Beggiatoa leptomitiformis
Pathway
blep00010  Glycolysis / Gluconeogenesis
blep00020  Citrate cycle (TCA cycle)
blep00620  Pyruvate metabolism
blep01100  Metabolic pathways
blep01110  Biosynthesis of secondary metabolites
blep01120  Microbial metabolism in diverse environments
blep01130  Biosynthesis of antibiotics
blep01200  Carbon metabolism
Module
blep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:blep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AL038_00880
   00020 Citrate cycle (TCA cycle)
    AL038_00880
   00620 Pyruvate metabolism
    AL038_00880
Enzymes [BR:blep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AL038_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N CAT
Motif
Other DBs
NCBI-ProteinID: ALG66555
UniProt: A0A2N9YCJ1
Position
complement(194261..195634)
Genome map
AA seq 457 aa AA seqDB search
MAIKEILVPDIGDFKDVQVIEILVNVGDTINKEQSLVTLESDKATMEVPSSDSGIVKELK
IKLGDRLSEGSAVLILETSAGAETPATAVETAPIASQSDMPRPPVVNVPAVPDMPVARNG
INDPRRPHALPATPDKPIAPLNIPDVDKSYASPSVRKFARELGVDLNKVQGSGRGGRILH
EDIQAFVKGVINQPPTVIVQQATAPATAPTGGMGIPEIPAIDFSKFGEIETRPLSRIKKI
SGNALHRAWLNVPQVTQFDDADITNLEAFRKSLSAEGEKRGAKVTFLTFLIKACVNALKT
YPDFNASLDPSKENLILKQYYNIGVAVDTPNGLVVPVVKNADRKGLFEIAADLGELSKKA
RDGKLSPNEMQGATFTISSLGGLGGTAFTPIVNAPEVAILGVSKSAMKPVYQNGEFVARL
MLPLSLSYDHRVIDGAAAARFTTTLCYLLADERNLLL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaatactagtccccgatattggcgactttaaagacgtacaagtcatt
gagattcttgtcaacgttggcgataccatcaacaaagaacaatcccttgtgaccctagaa
agcgacaaagccacgatggaagttccttcttccgactcaggcattgtcaaagaactaaaa
atcaaactcggcgaccgcctatccgaaggctctgccgtccttatccttgaaaccagcgcg
ggtgcggaaacccccgccacagcagtagaaacagcccccattgcctcacaatccgacatg
ccccgcccgcctgtcgtcaatgttcctgctgttcccgacatgcctgttgcacgcaatggc
atcaacgacccccgtcgcccccatgccctgcctgccacgcctgacaaacccatagctcct
ctcaacattcccgatgttgacaaaagctacgccagcccatccgtgcgcaaatttgcccgc
gaacttggtgttgatttaaacaaagtacaaggcagtggacgcggtggacgcatcctacac
gaagacatacaagccttcgttaaaggcgtgattaatcaaccgccaaccgttattgtccaa
caagccacagcccctgcaactgcacccacaggcggtatgggcatccccgaaattcctgcc
atcgacttcagcaaatttggcgaaatagaaacccgcccactcagtcgcatcaagaaaatt
tcaggcaacgccctacaccgcgcatggcttaacgtcccacaagtcacccaatttgatgat
gcagacatcaccaatttagaagccttccgtaaaagtttgagtgctgaaggcgaaaaacgc
ggggcgaaagtcacctttttaaccttcttaattaaagcctgcgtcaacgcgctgaaaacc
taccctgatttcaacgcctcactagaccccagcaaagaaaatctgatattaaaacaatac
tataatatcggtgttgcggtggacaccccaaacggcttagttgtacctgtggtgaaaaat
gcggatagaaagggtttatttgaaattgcggcagatttaggcgagttaagcaaaaaagcc
cgtgatggcaaattatcgccaaatgaaatgcaaggcgcgaccttcaccatttcctcactc
ggtggtcttggtggcacagccttcaccccgattgtaaacgccccagaagttgcaatttta
ggcgtttccaaatctgccatgaaacctgtctatcaaaacggcgaattcgtcgcccgcctg
atgttgcctttatcgttatcctatgaccatcgtgttattgatggcgcagcagccgcacgg
tttacgacaacgctatgttatttattagcggatgaaaggaatttgttgctgtag

DBGET integrated database retrieval system