KEGG   Beggiatoa leptomitiformis: AL038_03380Help
Entry
AL038_03380       CDS       T04090                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
blep  Beggiatoa leptomitiformis
Pathway
blep00071  Fatty acid degradation
blep00072  Synthesis and degradation of ketone bodies
blep00280  Valine, leucine and isoleucine degradation
blep00310  Lysine degradation
blep00362  Benzoate degradation
blep00380  Tryptophan metabolism
blep00620  Pyruvate metabolism
blep00630  Glyoxylate and dicarboxylate metabolism
blep00640  Propanoate metabolism
blep00650  Butanoate metabolism
blep00900  Terpenoid backbone biosynthesis
blep01100  Metabolic pathways
blep01110  Biosynthesis of secondary metabolites
blep01120  Microbial metabolism in diverse environments
blep01130  Biosynthesis of antibiotics
blep01200  Carbon metabolism
blep01212  Fatty acid metabolism
blep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:blep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL038_03380
   00630 Glyoxylate and dicarboxylate metabolism
    AL038_03380
   00640 Propanoate metabolism
    AL038_03380
   00650 Butanoate metabolism
    AL038_03380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL038_03380
   00072 Synthesis and degradation of ketone bodies
    AL038_03380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL038_03380
   00310 Lysine degradation
    AL038_03380
   00380 Tryptophan metabolism
    AL038_03380
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL038_03380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL038_03380
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL038_03380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blep04147]
    AL038_03380
Enzymes [BR:blep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL038_03380
Exosome [BR:blep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL038_03380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALG66933
UniProt: A0A2N9YB67
Position
796536..797723
Genome map
AA seq 395 aa AA seqDB search
MTIDPIVIVSYARTAMGGFQGIFNNVSAPELGGTAIKAAVARAGLQADDIQEVLMGCVLP
AGLGQAPARQAALLGGLPVHVGCTTISKVCGSGMKATMLAHDLLVAGTQDIILAGGMESM
SNAPYLLPKARAGYRLGHGQIIDHMFFDGLEDAYFDKGRLMGTFAEDCASLYHFSREDQD
QFAITSLHRAQKAIAEGLFQREITPYLLTDKKGDVLLAEDEQPNKANISKIPSLKPAFKK
DGTVTPANSSSISDGAAALVLMRRSTAEQRGIKPLAVIHGHTTHAQAPNLFTTAPIGAIN
ALFQKTGLTAQQIDLYEINEAFAVVTMAAMQTLQLPAEKVNVHGGACALGHPIGASGARI
IVTLLAALEQYDLKMGVASLCIGGGEATAIAIERV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagacccgattgttattgtcagttatgcccgtactgcaatgggtggatttcag
ggcatttttaacaacgtcagcgcgcccgagttgggtggcacagcgattaaagccgctgtc
gcacgtgcaggcttgcaagctgacgatattcaagaagtattaatgggttgcgtattaccc
gcaggattaggacaagcccccgcacgtcaagccgcattattgggcggtttacctgttcat
gtgggttgcacaacaattagtaaagtttgtggctcgggcatgaaagcgacgatgttagcc
catgatttattagtagcaggcacacaagacatcatccttgcgggcggtatggaaagcatg
agcaacgcaccgtatttgctccctaaagcacgcgctggctaccgtttaggacatggacaa
atcatcgaccacatgttttttgacggtttagaagatgcgtactttgacaaagggcgatta
atgggaacatttgccgaagattgcgcaagtctgtatcactttagccgtgaagaccaagac
cagtttgcaattacttctttacatcgcgcccaaaaagccattgctgagggattatttcaa
cgagaaataaccccttatttattaaccgataaaaaaggcgatgtattactggcagaagat
gagcaaccgaataaagccaatatcagcaaaattccctcattaaaacctgcctttaaaaaa
gatgggacggtaacgcctgctaattccagctcgatttctgatggtgctgctgccttagta
ttaatgcgccgttccaccgcagaacagcgtggcattaaaccgctcgccgtcattcacgga
cacacaacccacgcacaagcacccaatttattcaccactgcacccattggcgcaatcaat
gccttatttcaaaaaacaggccttaccgcacaacaaattgatttatacgaaattaacgag
gcttttgcagttgtaacgatggccgccatgcaaaccttgcaactgcccgctgaaaaagta
aacgtgcatggtggtgcttgcgcgctagggcatccgataggggcatcaggtgcgcgcatt
atcgtcacattactagcggcattagaacaatacgatttaaaaatgggtgttgcatcctta
tgtattggcggtggagaagcgaccgcaatcgccattgaaagggtttaa

DBGET integrated database retrieval system