KEGG   Beggiatoa leptomitiformis: AL038_13120Help
Entry
AL038_13120       CDS       T04090                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
blep  Beggiatoa leptomitiformis
Brite
KEGG Orthology (KO) [BR:blep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AL038_13120
Enzymes [BR:blep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     AL038_13120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ALG68468
UniProt: A0A2N9YFC4
Position
complement(3133486..3134307)
Genome map
AA seq 273 aa AA seqDB search
MTRIAALQMISTTDVNTNLQEAARLIAQAADQGAELVSLPENFALMGQHDTDKVKIRESF
GQGHIQDFLATQATKYGVWLIGGTIPLVADAPDKVRAACLVLNNSGQCVARYDKMHLFDV
MVSPEESYCESRTIEAGHNTNVVDTPFGRIGLAICYDVRFPELFRCLTAQGATIISLPSA
FTAMTGKAHWEILVRARAIENLSYVLAPNQGGVHANGRETYGDSLIVDPWGNILSRLGQG
AGIIYADLDPTYLQTIRRNFPTLDHKRIACQQP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgccgctttacagatgatttccactaccgatgtaaacaccaatttacaa
gaggcagcgcgtttaatcgcccaagcggctgaccaaggggctgaacttgtcagtctgccc
gaaaattttgcccttatgggacaacatgacactgacaaagtaaaaattcgtgaatctttt
ggtcaaggacacatacaagatttcctagccacacaagccactaaatacggtgtttggttg
attggcggcacaatcccactcgttgcggatgcgcccgacaaagttcgtgcagcctgctta
gtattgaataacagcggtcaatgcgtcgcacgttatgataaaatgcacctctttgatgtc
atggtaagtcctgaagaaagctattgcgaatcacgaaccattgaagcaggacataacacc
aatgtggttgatacaccgtttggacgtatcggattagccatctgttatgatgttcgtttt
cctgaattattccgttgccttactgcacaaggggcgactattatcagtttaccctcagcc
tttacagcaatgacagggaaagcacattgggaaattctcgttcgcgcccgtgcaattgaa
aatctaagctatgttcttgcaccgaatcaaggcggtgttcatgctaatggacgcgaaacg
tatggcgatagcctgattgtcgacccttggggaaatatactttcccgtttaggacaaggg
gcaggcatcatctacgcagaccttgacccaacatatttacagacaatacggcgtaatttt
ccaaccctagaccacaaaagaatcgcatgtcaacagccctaa

DBGET integrated database retrieval system