KEGG   Beggiatoa leptomitiformis: AL038_13900Help
Entry
AL038_13900       CDS       T04090                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
blep  Beggiatoa leptomitiformis
Pathway
blep03010  Ribosome
Brite
KEGG Orthology (KO) [BR:blep00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AL038_13900 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:blep03011]
    AL038_13900 (rplV)
Ribosome [BR:blep03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AL038_13900 (rplV)
  Bacteria
    AL038_13900 (rplV)
  Archaea
    AL038_13900 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALG68593
UniProt: A0A2N9YEZ1
Position
complement(3300337..3300669)
Genome map
AA seq 110 aa AA seqDB search
METVSKYKYAHISPQKCRLVADLIRGLSVDKALDILNFSNKKAALMVKKALEAAIANAEH
NEGADVDELKVARICIDEGPVMKRMHARAKGRGNRITKRTSHITVAVADR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgttagcaaatataaatatgcgcacatttctccgcagaaatgtcgcttggtg
gctgacttaattcgtggtttatctgtggataaggccctcgatattcttaatttcagcaat
aaaaaagctgcgcttatggttaaaaaagccttggaagcagcaatcgcaaatgccgaacac
aatgaaggggctgatgtagatgagttgaaggtagctcgtatctgcatcgatgaaggtcct
gtcatgaagcgaatgcacgctcgtgcaaaagggcggggcaatcggattactaaacgtacc
agtcatattacggttgctgttgccgatcgttga

DBGET integrated database retrieval system