KEGG   Beggiatoa leptomitiformis: AL038_14365Help
Entry
AL038_14365       CDS       T04090                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
blep  Beggiatoa leptomitiformis
Brite
KEGG Orthology (KO) [BR:blep00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AL038_14365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ALG68671
UniProt: A0A2N9YER5
Position
complement(3415327..3416943)
Genome map
AA seq 538 aa AA seqDB search
MSLSAADAILPSLGGKPNLDHKANLLTVAIFVGLLITGLGFAGYSLAIDISGSGAVSDNL
FPYFLLVVALLIALGFEFVNGFHDTANAVATVIYTHSMKPNLAVMWSGAFNFLGVLVSSG
AVAFGIISLLPVELILQVGSGSGFAMVFALLIAAILWNVGTWLLGLPASSSHTMIGSIIG
VGVANALMHGRDGTSGVDWTQVSKVGYSLLLSPMVGFGVAALLLLVLKLVVKNKALYEAP
KGNEPPPWWIRSLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTAPIAYSLNRAMPVEHS
ATFLAVSQAAKASLEKAAKVAAPEDVRKSVTEYIRTKSYQPEVIPALAYLVGDIAVQVKQ
HGSLANVPANLVPNVRSDMYLASESLQLMGKDSNLSFDEDSKGNLKALKKELDNATKFIP
LWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGASAELVAMTTIGAADIFGLP
VSTTHVLSSGVAGTMVANKSGLQLATIKNLVMAWVLTLPVAMLLSGSLFWLFTMVFVG
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatccgctgctgatgcaatactaccatccttaggtggtaaacctaatctggat
cataaagccaatctattaacggttgctatatttgtaggactgttgataacaggtctagga
tttgcgggatatagtttagcaattgatatttctggctctggagcagtttctgacaatctg
ttcccctactttttgctggttgttgccttactgattgcgttgggttttgagtttgtgaat
ggttttcacgatacggccaatgcggttgctaccgtcatttatacccactctatgaaaccc
aatttggcggtgatgtggtcgggtgcttttaactttttaggggtgttggtttccagcggt
gctgtggcatttggcattatttccttattgcccgtagagttgattttacaagttggttca
ggttctggatttgctatggtgttcgcgctgctaattgcggctattttgtggaatgtaggc
acgtggttattgggcttacctgcctcctcctcacacaccatgattggttcaattattggt
gtaggggttgcgaatgcactcatgcacgggcgtgatggcactagtggtgtggattggacg
caagtttctaaagttggttattccctattgctatctccgatggtgggttttggagtagct
gcattattgttgttggtacttaaacttgtagtaaagaataaagcactatatgaagcccct
aaaggtaatgaaccacccccttggtggattcgtagtttgctaattttaacttgtacaggg
gtttcctttgcacatggttcaaatgatggtcaaaaagggatggggctgattatgttaata
ttaatcggtacagctcccattgcttattctttaaaccgtgcaatgcctgtagaacattca
gcgacgtttctcgcagtatctcaagcagcaaaagcttcattggagaaagcggctaaagtt
gcagcccccgaggatgtgcgtaaatcggtaactgaatacattcgtactaaaagctatcag
cctgaagtgattcctgcattggcttatctggtgggtgatattgctgtgcaagttaaacag
catggcagtttagcgaatgttcctgcgaatttagtacctaacgtgcgtagcgatatgtac
ttagcatctgaatctctgcaattaatgggaaaagatagcaaccttagttttgatgaagac
agcaaaggtaatttgaaagcacttaagaaagagctggacaacgccactaaattcattcca
ttgtgggtaaaaattgctgtcgctatcgcgttgggtttgggtacgatggttggctggaaa
cgtattgttgtcactgtgggtgagaaaattggtaaaacccatttaacttatgctcaaggt
gcatcagcagaattggttgcaatgaccacgattggtgcggcggatatctttggtttgccc
gtgtccaccacacatgtgctgtcttctggtgtagcaggcacaatggttgcgaataaatcg
ggtttacagttagcaacgattaaaaatctcgtgatggcatgggtcttaaccttgcctgtt
gcgatgctgttatcgggtagcttgttctggttgtttacaatggtgtttgttgggtag

DBGET integrated database retrieval system