KEGG   Beggiatoa leptomitiformis: AL038_16365Help
Entry
AL038_16365       CDS       T04090                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
blep  Beggiatoa leptomitiformis
Pathway
blep00020  Citrate cycle (TCA cycle)
blep00640  Propanoate metabolism
blep00660  C5-Branched dibasic acid metabolism
blep01100  Metabolic pathways
blep01110  Biosynthesis of secondary metabolites
blep01120  Microbial metabolism in diverse environments
blep01130  Biosynthesis of antibiotics
blep01200  Carbon metabolism
Module
blep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
blep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:blep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL038_16365 (sucC)
   00640 Propanoate metabolism
    AL038_16365 (sucC)
   00660 C5-Branched dibasic acid metabolism
    AL038_16365 (sucC)
Enzymes [BR:blep01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AL038_16365 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 OKR_DC_1_N GARS_A
Motif
Other DBs
NCBI-ProteinID: ALG68975
UniProt: A0A2N9YDS2
Position
3837106..3838272
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQSKKLFTDYGVPVPNGYPAFSPEEAKQRAQALGGSSWMVKAQVHAGGRGKAGGV
KKANSLEEVAQITESLLGKRLVTHQTGAEGQPVGCVLIETPSAINSELYLSLLVDRGSKR
IAIIASAAGGMDIEEVAAHTPEKITTLMVDPVVGIQAYQCNEVAFALGLDATQRKQLLYI
LPSLYRLFKDKDLSLLEINPLITTDKGDLLALDGKINLDDNALYRHTDLAAFYDASQEDE
KEHRARQFDLNYVALDGDIACMVNGAGLAMATMDVIKLHGGNPANFLDVGGGTNTAKVTE
AFKIILSDTKVKAILVNIFGGIVRCDMIAEGVIHAMKETGTKLPVIVRLEGTNVEAGKTL
LRESGLSVTAADDLTDAAKKAVSLVKGA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacacgagtatcaatcaaaaaaactgttcaccgactatggtgtgccagtgcct
aatgggtatcccgcttttagtcccgaagaagccaaacaacgcgctcaagccctagggggt
tctagttggatggttaaagcccaagttcatgctggcggacggggtaaagcgggtggtgtg
aaaaaagccaatagtttggaagaagttgcacaaatcaccgaaagtttattaggtaaacgc
ttagtaacacatcaaacaggggctgaaggtcagcctgttggttgcgtgttaatagaaacc
cccagtgcgattaatagcgagttatacctcagcttattagtcgaccgtggtagcaagcgc
attgctattattgcttctgcggctggtgggatggatattgaagaagttgctgcccatacc
cctgaaaaaattaccacattgatggttgaccctgttgtcggtattcaagcctatcaatgt
aatgaagtcgcgtttgccctaggtttagatgcaacccaacgtaaacaattactttatatt
cttcccagcttataccgtttattcaaagataaagatttaagcctgttagaaatcaatcca
ttaatcacgactgataaaggcgatttattagcgttagatggtaagattaatctggatgac
aacgcgctataccgtcataccgatttagctgcattttatgatgcttctcaagaagatgag
aaagaacatcgcgcccgccaatttgatttaaactacgtagcattagatggcgatatcgct
tgtatggtgaacggtgcgggtttagcaatggcaaccatggacgtaattaaattacatggt
ggcaaccctgcaaacttcttagacgtaggcggtggtactaacacagccaaagtgactgaa
gcattcaaaatcattctctctgacaccaaagttaaagccattctggttaatatcttcggc
ggtattgtccgttgcgatatgattgcagaaggcgttatccatgcgatgaaagaaacggga
acaaaactacctgttatcgtccgtttagaagggacaaacgtcgaagcaggtaaaacgtta
ttaagagaaagcggtttatccgtcactgccgctgatgatttaactgatgccgcgaaaaaa
gcggttagcttagtcaagggagcgtaa

DBGET integrated database retrieval system