KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1094Help
Entry
BLIF_1094         CDS       T01420                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00010  Glycolysis / Gluconeogenesis
blf00051  Fructose and mannose metabolism
blf00562  Inositol phosphate metabolism
blf01100  Metabolic pathways
blf01110  Biosynthesis of secondary metabolites
blf01120  Microbial metabolism in diverse environments
blf01130  Biosynthesis of antibiotics
blf01200  Carbon metabolism
blf01230  Biosynthesis of amino acids
Module
blf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIF_1094
   00051 Fructose and mannose metabolism
    BLIF_1094
   00562 Inositol phosphate metabolism
    BLIF_1094
Enzymes [BR:blf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BLIF_1094
Exosome [BR:blf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BLIF_1094
  Exosomal proteins of bladder cancer cells
   BLIF_1094
  Exosomal proteins of melanoma cells
   BLIF_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA_26
Motif
Other DBs
NCBI-ProteinID: BAJ71236
UniProt: E8MTZ2
Position
complement(1259681..1260484)
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAKLIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVRILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSTKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttt
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtgcaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatcttggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgctcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccaaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacttttggcacgaaggtatccgatagcgtacgtatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccctggacgttgaggaactcgccaaaatcgctcgactggcactg
aaatccacgaaatcacggaactaa

DBGET integrated database retrieval system