KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1143Help
Entry
BLIF_1143         CDS       T01420                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00010  Glycolysis / Gluconeogenesis
blf00260  Glycine, serine and threonine metabolism
blf00680  Methane metabolism
blf01100  Metabolic pathways
blf01110  Biosynthesis of secondary metabolites
blf01120  Microbial metabolism in diverse environments
blf01130  Biosynthesis of antibiotics
blf01200  Carbon metabolism
blf01230  Biosynthesis of amino acids
Module
blf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIF_1143
  Energy metabolism
   00680 Methane metabolism
    BLIF_1143
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLIF_1143
Enzymes [BR:blf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLIF_1143
Membrane trafficking [BR:blf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BLIF_1143
Exosome [BR:blf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLIF_1143
  Exosomal proteins of melanoma cells
   BLIF_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Glyco_hydro_108
Motif
Other DBs
NCBI-ProteinID: BAJ71285
UniProt: E8MU41
Position
complement(1318323..1319168)
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLAEHP
EAIAQPGPDAAERTDTRQFEEAPAAGRRMVVMTSDLFRAQQTAHAFADILGLPVTCDQRL
RERSFGEWEGMTRAEIKAVAADDYASWKQHTGGETKHGVESRAAVGQRGADAVRALVIDS
AYSDSTPTTLMLVTHGSWITATISNLLELDPDGMNALGGMRNACWCRLKVRHSVNGTPIE
QPLWELEEYNKAPAIADSADWENGPTDLRGPHMPSWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgatgctgcgtcatggccgtacgcaatacaatctcgaacatcgc
ttgcaaggccagatcgatgtgcctctcgacatcgtaggccaatggcaggttgaccagacc
ggattcgcgctcgcttcacggtattactgggccaaggtgaaccgacttgccgagcatccc
gaagccatcgcccagcccggtcctgacgccgccgaacgcactgatacgcgccagttcgag
gaggctcccgccgccggccggcgcatggtggtgatgacctccgacctgttccgtgcccaa
cagaccgcacacgccttcgccgatattttgggattgccagtcacctgtgaccaacgactg
cgtgaacgcagcttcggcgagtgggaaggcatgacccgcgccgaaatcaaagccgtggca
gccgacgactacgcctcttggaaacagcacactgggggcgaaaccaagcatggtgtggaa
agccgtgccgccgtggggcagcgaggtgccgatgccgtgcgcgcactggtcatcgactcc
gcctattcagacagcacgcccaccacgctgatgctcgtcacccatggctcatggattacc
gccaccatctccaacctgctcgaacttgacccggacggcatgaacgcactcggcggcatg
cgcaacgcctgttggtgccggctcaaagtgcgccacagcgtcaacggcacccccatcgaa
cagcccctgtgggagttggaggaatacaacaaggctcccgccatcgccgacagcgccgac
tgggagaacgggccgaccgatctgcgaggaccgcacatgccaagttggcagccaatcgtc
tggtga

DBGET integrated database retrieval system