KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1298Help
Entry
BLIF_1298         CDS       T01420                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00520  Amino sugar and nucleotide sugar metabolism
blf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLIF_1298
Enzymes [BR:blf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BLIF_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: BAJ71438
UniProt: E8MUJ4
Position
complement(1503377..1504660)
Genome map
AA seq 427 aa AA seqDB search
MSDRNEIVSRVTAALEGKPAPVAIRNARKVDARGERRGYWVVSDAAGVIMAAGTGEGTFE
HCCRTVGLDPADRNAVIDAEGRILTPGYVDIHAHGAWEKSFDDGPDGIDVARAGHAVHGT
TRQVLSLITNPVDVICRNIRTVRATMESGRPDILGCHLEGPFLALARKGAHDPECLKDPV
PDIVDKMLEASGADPASGKLGCIRQITIAPELPHGISAIRQFAAAGVVPAVGHCDADYET
AKAGFDAGAGIMTHMFNAMNGLHHREPGPIPAAVEDPRVTIELINDGFHVQDPMVSLSFR
FAPHRTAFVTDAMAATDCPDGAYKLGALDVNVVDGHARLVSNGAIAGSTLLLEVAVRRAV
DELGFSPVDAVEAATLTPAKAFGFDRPNPVTGAPIGLIAPGFAADFNLADPADWTVEQVW
CAGRKLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataggaacgagatagtctcgcgcgtgaccgcggcactggagggcaagccggct
ccggtggcgattcgtaacgcgcgcaaggtggatgcgcgcggcgaacggcgcggatattgg
gtcgtctccgatgccgccggcgtcatcatggcggccggcacgggggaggggaccttcgag
cactgctgccgcacggtggggctcgacccggccgatcgcaacgcggtcatcgacgccgaa
ggccgtattctgacccccggctacgtggacatccacgcgcacggcgcatgggagaagagc
ttcgatgacgggccggacggcatcgacgtggcgcgggccggccacgccgtgcatggcacc
acgcgccaggtgctctcgctgatcaccaaccccgtggacgtgatctgccgcaacatccgc
accgtccgcgccacaatggagtccggccgccccgacatcctaggctgccatctggaaggc
ccgttcctggccctggcccgcaagggcgcacatgacccggaatgtctcaaggatccggtg
cctgacatcgtcgataagatgcttgaggcctccggtgccgaccccgcctccggcaagctt
ggctgcatccgccagatcaccatcgcccccgaactgccccacggcatctccgccatccgc
cagttcgccgctgccggcgtggtgccggccgtgggccactgcgacgccgactacgagacc
gccaaagccggcttcgacgcgggcgcgggcatcatgacccacatgttcaacgcgatgaac
ggcctgcatcaccgcgaacccggtccgattccggccgcggtggaggacccgcgcgtcacc
atcgagctcatcaacgacggattccacgtgcaggatccgatggtgagcctctccttccgg
ttcgcgcctcaccgcacggccttcgtgaccgacgcgatggccgccaccgactgcccggac
ggcgcctacaagttgggcgcgctggacgtgaacgtggtcgatgggcatgcgcgcctggtc
tccaacggtgccatcgccggctccactctgctgctggaggtcgccgtgcgccgtgcggtg
gacgaactgggcttcagcccggtggacgcggtcgaggcggccactctgacgccggccaag
gcgttcggcttcgaccggccgaacccggtcaccggggcgccgatcggcctcatcgccccc
ggcttcgccgccgatttcaaccttgcggacccggccgactggacggtcgaacaggtgtgg
tgcgcgggccgcaagctcaagtag

DBGET integrated database retrieval system