KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1460Help
Entry
BLIF_1460         CDS       T01420                                 

Definition
(GenBank) sugar ABC transporter ATP-binding component
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:blf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BLIF_1460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blf02000]
    BLIF_1460
Enzymes [BR:blf01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     BLIF_1460
Transporters [BR:blf02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    BLIF_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_30 RsgA_GTPase SbcCD_C AAA_23 MMR_HSR1 AAA_27 AAA_22
Motif
Other DBs
NCBI-ProteinID: BAJ71599
UniProt: E8MV05
Position
complement(1701402..1702943)
Genome map
AA seq 513 aa AA seqDB search
MTDKNPIVVMKGITIEFPGVKALDGVDLTLYPGEVHALMGENGAGKSTMIKALTGVYKIN
AGSIMVDGKPQQFNGTLDAQNAGIATVYQEVNLCTNLSVGENVMLGHEKRGPFGIDWKKT
HEAAKKYLAQMGLESIDPHTPLSSISIAMQQLVAIARAMVINAKVLILDEPTSSLDANEV
RDLFAIMRKVRDSGVAILFVSHFLDQIYEITDRLTILRNGQFIKEVMTKDTPRDELIGMM
IGKSAAELSQIGAKKARREITPGEKPIVDVKGLGKKGTINPVDVDIYKGEVVGFAGLLGS
GRTELGRLLYGADKPDSGTYTLNGKKVNISDPYTALKNKIAYSTENRRDEGIIGDLTVRQ
NILIALQATRGMFKPIPKKEADAIVDKYMKELNVRPADPDRPVKNLSGGNQQKVLIGRWL
ATHPELLILDEPTRGIDIGAKAEIQQVVLDLASQGMGVVFISSELEEVVRLSDDIEVLKD
RHKIAEIENDDTVSQATIVETIANTNVNTGKEA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaaaaccccatcgtcgtaatgaaaggcattacgattgaattcccgggcgtc
aaggccttggatggtgttgatttgactctctacccgggtgaagttcacgccctgatgggt
gagaacggtgcaggcaagtccaccatgattaaggctctgaccggtgtgtacaagatcaac
gccggctccattatggtggacggcaagcctcagcagttcaacggcaccctcgacgcacaa
aacgccggtatcgccaccgtgtatcaggaagtgaacctgtgcaccaacctttccgtcggt
gagaacgtgatgctgggccacgaaaagcgcggccccttcggcatcgactggaagaagacc
cacgaggccgccaagaagtatttggcacagatgggcctcgaatccattgacccgcacact
ccgctgagctccatctccatcgctatgcagcagctggtcgccatcgcccgcgctatggtt
atcaacgccaaggtgctgattctcgatgagccgacctcttcgctggatgccaacgaggtc
agggacctgttcgcgatcatgcgcaaggtacgtgactcgggcgtggccatcctcttcgtc
tcccacttcctcgatcagatttatgagattaccgatcgtctgaccattctgcgtaacggc
cagttcatcaaggaggtcatgaccaaggacaccccgcgcgacgaactcatcggcatgatg
attggtaagtccgccgccgagctgtcccagattggtgccaagaaggctcgccgtgaaatc
acccctggcgagaagccgatcgtcgatgtcaagggcctcggcaagaagggcaccatcaac
ccggttgatgttgacatctacaagggtgaggtcgttggcttcgctggcctgctgggctcc
ggtcgtaccgagcttggtcgactcctgtatggtgccgacaagccggattcgggtacctac
acgctcaacggcaagaaggtcaacatctccgatccgtacacggctttgaagaacaagatc
gcgtactccaccgaaaaccgtcgtgatgagggcatcatcggcgacctgaccgtccgccag
aacatccttatcgccctgcaggcaacgcgcggtatgttcaagccgattcccaagaaggaa
gcggacgccatcgttgacaagtacatgaaggaactcaacgttcgtcccgccgacccggat
cgcccggtcaagaatctctccggcggcaaccagcagaaggtgctcattggccgttggctg
gccacgcaccccgagctgctgattctggacgagccgacccgtggtatcgatatcggtgcc
aaggctgaaattcagcaggtcgtgcttgacctggcttctcagggcatgggcgttgtcttc
atctcctccgagcttgaagaggtcgtgcgtctgtccgacgacatcgaggttctcaaggac
cgccacaagatcgcagaaatcgaaaacgacgacaccgtctctcaggcgaccatcgtcgaa
accatcgctaacaccaacgtaaacaccggaaaggaggcatga

DBGET integrated database retrieval system