KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1964Help
Entry
BLIF_1964         CDS       T01420                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00460  Cyanoamino acid metabolism
blf00500  Starch and sucrose metabolism
blf01100  Metabolic pathways
blf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLIF_1964
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BLIF_1964
Enzymes [BR:blf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BLIF_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C GtrA RHH_5 OSTbeta
Motif
Other DBs
NCBI-ProteinID: BAJ72098
UniProt: E8MWF4
Position
complement(2353736..2355397)
Genome map
AA seq 553 aa AA seqDB search
MELEELSVTEKAAMLSGGSEWDSRGNEKAGIPNFVMSDGPHGVRRQLGEGDHLGLGSSKP
ATCFPTAGTVASSWDPALAEEMGKALGNEAHDLDVNVLLGPGLNIKRNPLCGRNFEYYSE
DPIVAGRMAAGLIRGIQSNGVSACPKHFAVNSQELRRQASNSVVDERTMREIYLTAFEIA
VREAAPMTIMTSYNEINGVYAHENKHLLQDILRNEWGFDGMVVSDWGGSNSAVAAVKAGG
SLEMPSPGYTSVRELEGAVKAGTLSEADLNARAAEVAKIARLTKTEGVGRDDLLKDAVAA
AHHEIARKVAENSSVLLKNASATLPLQSGTRVAVIGDMAKTPRFQGSGSSKVNATREENI
LDELKNAAAATGVTVAGYAQGYDRQGTKNQTLIDEAKTLAAADTTDAVIAVVGLDERSES
EGLDRSTMAIPQVQNDLVDALTATGKPVIIVLVGGFLTFLFAEVIAQAVNFFVQMKWVFK
SDSSFKDAAWKYAILAVVVVVVNLVLPGYVTSLCQGWGMNAGVAGTIASVVNTLLAVIVS
YPLLKFWIMPKNK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgaagaactatcggtcaccgagaaagccgcgatgctctcaggtggctccgaa
tgggattcccgcggcaacgagaaggccggcatccccaacttcgtgatgagcgacggtccc
cacggtgtgcgccgccagctcggcgaaggcgaccatctgggtctggggtcatccaagccc
gccacctgcttcccgaccgccggcaccgttgccagctcctgggatccggcgctcgccgaa
gaaatgggcaaggcacttggcaacgaagcgcacgatctggacgtgaatgtgctgctcggc
ccaggcctgaacatcaagcgcaacccgctgtgcggccgcaattttgagtactattccgaa
gaccctatcgtggccggtcgtatggcagccggtctgattcgcggcattcagtccaacggt
gtttccgcctgcccgaagcatttcgcggtcaacagccaggagctgcgccgtcaagcctcc
aactccgtggtcgatgagcgcacgatgcgcgagatctacctgaccgcgtttgaaatcgcc
gtgcgtgaggccgcgccgatgaccatcatgacttcgtacaacgagatcaatggcgtttac
gcgcacgagaacaagcacctgctgcaggacatcttgcgcaatgagtggggtttcgatggc
atggtcgtctccgactggggcggctccaactccgccgtggccgcggtcaaggccggtggc
tcgctcgaaatgccgtcgcccggctacacctccgtgcgcgaactcgaaggcgcggtcaag
gccggcaccttgtccgaggccgacctcaacgctcgtgccgccgaagtcgccaagatcgca
cgactgaccaaaaccgagggcgtaggccgagacgacctgctcaaagatgccgtcgccgct
gcgcaccacgaaatcgctcgtaaggtggccgagaactcgtccgtgctgctcaagaacgct
tccgccacgctgccgctacagtccggcactcgcgtcgccgtaattggcgacatggccaaa
accccgcgattccaaggctccggctcttccaaggtgaatgccactcgcgaagagaacatc
cttgatgagctcaagaacgccgcagcagccaccggcgtgaccgtggccggctacgcgcaa
ggctacgaccgccaaggaaccaagaaccagacgctcatcgacgaagccaaaacgctcgcc
gccgccgacaccactgatgcggtgatcgccgttgtcggcctcgacgagcgcagcgaatcc
gagggcctcgaccgttccaccatggcgatcccgcaagtgcagaacgatctggtcgacgcc
ctgaccgccaccggcaagcccgtcatcatcgtgctcgtgggcggcttcctcaccttcctg
tttgccgaggtcatcgcgcaggcagtcaacttcttcgtgcagatgaagtgggtgttcaag
tctgactccagcttcaaggatgccgcttggaagtacgcgattctcgccgtggtggtcgtg
gtcgtcaatctggtactgccgggctacgttacctctctatgccagggctggggcatgaac
gccggcgtggccggcaccatcgcctccgtggtcaacaccttgctcgccgtgattgtcagc
tacccgctgctcaagttctggatcatgccgaagaacaagtaa

DBGET integrated database retrieval system