KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1975Help
Entry
BLIF_1975         CDS       T01420                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Pathway
blf00900  Terpenoid backbone biosynthesis
blf01100  Metabolic pathways
blf01110  Biosynthesis of secondary metabolites
blf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:blf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BLIF_1975
Enzymes [BR:blf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BLIF_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: BAJ72109
UniProt: E8MWG5
Position
2366160..2367110
Genome map
AA seq 316 aa AA seqDB search
MSPVISHPRSAAARHQSDELSPITITVDCPAKTNLTLEVGPAHDEWGGRHELDTIYCAIG
VYDTVTATAKQPGAGFSLELEGAYLGDLASSRSDMRRNHAVLALFAMAQAAEREPDVALT
ITKRIPVGAGLGGGSADAAATMLAVNRLWELNWPIERLRTIAATLGADMPFCLTGGLAYG
TGFGERITDIAPGSRDELALIEQGFSGEVLVGAYQSQLSTPEVYHTFDIVGAAEGDRNHL
QAAAISLHPRSGQAIDAATQAGASHAFVSGSGPSVVAFAADEAAAQRIIEVWRDTAVVDR
IIRAKSPEHPNISVRQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggtaatctcacatccacgctcagccgctgcccgacatcagtccgatgagctc
tcccccatcaccattacggtggattgcccggcgaaaaccaatctcaccttggaagtggga
cctgctcacgacgaatggggcggacgccacgaactggacaccatctactgcgcaatcggc
gtatacgacaccgtcaccgcaaccgccaagcaacccggagcaggattctctctggagctc
gaaggcgcttatttgggcgacttggcctcctcacgcagcgacatgcgccgcaaccatgcg
gtactggccctcttcgccatggcccaggcggccgagcgcgagccggatgtggcgttgacc
atcaccaagcgcattcccgtgggtgccggactaggcggcggttcagccgacgccgcggcg
accatgctggcggtcaatcgtctctgggagctgaactggcccatagagcgcctgcgcacc
attgctgccacgttgggcgcggacatgccgttctgcctgaccggtggccttgcatacggc
accggtttcggcgaacgcatcacggatatcgcccccggcagccgcgatgagctggcgctg
atagaacagggattcagcggcgaagtattggtcggcgcataccagtcgcaactcagcact
cctgaggtctaccacacctttgacatcgtgggagccgcagaaggcgaccgcaatcatctg
caggctgcggcaatcagcctgcatccccgcagcgggcaggccatcgacgccgccacgcag
gcgggtgccagccatgcattcgtctccggatccggcccctcagtggtcgctttcgccgcc
gacgaggcagcggcacaacgcattatcgaggtgtggcgcgatacagctgtggtcgatcgt
attattcgagccaaatctcccgaacaccccaatatcagcgtcagacagtga

DBGET integrated database retrieval system