KEGG   Bacillus paralicheniformis: BaLi_c04380Help
Entry
BaLi_c04380       CDS       T02694                                 

Gene name
bsdB
Definition
(GenBank) phenolic acid decarboxylase beta subunit BsdB
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00130  Ubiquinone and other terpenoid-quinone biosynthesis
blh00627  Aminobenzoate degradation
blh01100  Metabolic pathways
blh01110  Biosynthesis of secondary metabolites
blh01120  Microbial metabolism in diverse environments
blh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BaLi_c04380 (bsdB)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BaLi_c04380 (bsdB)
Enzymes [BR:blh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BaLi_c04380 (bsdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AGN34851
Position
441575..442144
Genome map
AA seq 189 aa AA seqDB search
MNIIVGITGATGAIFGVRMLEWLKKTDAETHLVISPWAAATILHETGYTMKDVEKLASFT
YSHKDQAARISSGSFQTDGMIVAPCSMKTLAGIRTGMADNLLTRSADVMLKERKKLVLLT
RETPLNQIHLENMLELTKMGAVILPPMPAFYNHPQNLTEMVDHIVFRTLDQFGIHLSEAK
RWEGMKQKK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatcgtcggaattacgggcgcgaccggcgcgatatttggcgtgcggatgctg
gagtggctgaagaaaaccgacgcagagacacacctagtcatctctccgtgggcagcggca
acgattctgcacgaaacgggatatacgatgaaagacgtagaaaagctcgcatcttttacg
tattcccacaaagaccaggcggcccgcatttcaagcggttcctttcaaacggacggaatg
attgtcgcaccgtgcagcatgaagacgttggcgggcattcgcaccggtatggcggataac
ctgttgacccgttcggcggacgtcatgctgaaggaacggaaaaagcttgtgctgttaaca
agggagacgccgctgaaccagattcatcttgaaaacatgcttgagctgacaaaaatgggc
gcggtgatcctgccgccgatgccggctttttataatcatccccaaaatttgaccgaaatg
gtcgaccatatcgtattccggacgctggaccaatttggaatccatctgtctgaagcgaag
cgctgggaaggaatgaaacagaagaaataa

DBGET integrated database retrieval system