KEGG   Bacillus paralicheniformis: BaLi_c15030Help
Entry
BaLi_c15030       CDS       T02694                                 

Gene name
pit
Definition
(GenBank) low-affinity inorganic phosphate transporter Pit
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
blh  Bacillus paralicheniformis
Brite
KEGG Orthology (KO) [BR:blh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BaLi_c15030 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGN35871
Position
complement(1463946..1464944)
Genome map
AA seq 332 aa AA seqDB search
MDLLFVLTILIVIFALAFDFINGFHDTANAIATSVSTKALKPRHAIIMAAVMNFAGAMTF
TGVAKTITSDIADPFKLENGSVVILAALIAGITWNLVTWYFGIPSSSSHAIIGAIAGAVI
ASEGFAAIKYHGFIKIIEALILSPVLAFVLGYLIYSIVKVIFKNSNLAKTNKRFRRVQIA
TAAIQSYTHGTNDAQKAMGIITMALIAGNLHSTTDIPFWVQFACATAMGLGTSVGGWKII
KTVGGKIMKIRPVNGVSADLTGALIIFGATIVHLPVSTTHVISSSILGVGASHRVKGVNW
GTAKRMLITWVITLPISATIGAFAYFILDLFF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttatttgtattaaccatattgattgtcatctttgctttggcatttgacttt
atcaacgggtttcatgatacggcaaatgcgatcgccacctcggtatcgacaaaagcgtta
aaaccaaggcacgccattataatggcggctgtcatgaacttcgccggcgccatgacgttc
acaggcgtagcgaaaaccattacgagcgatatcgccgaccctttcaaactggaaaacgga
tcggtcgtgatccttgcagctcttatcgcgggcattacatggaacctggtgacttggtat
ttcggcattcccagcagctcatcccacgcgatcatcggagcgattgccggagctgtcatt
gcatcggaaggattcgccgcgattaaataccacggatttattaaaattatcgaagcactt
atattatcgcccgttttggcgtttgttttaggatatttgatctacagcatcgtcaaagtc
atttttaagaacagcaatctggccaaaacgaataagcggttccggcgcgttcaaatcgcg
acagctgccatacagtcctatacgcacggcacgaacgatgcacagaaagcgatgggtatc
attacgatggctttaattgcgggtaacttgcacagtacaaccgatatcccgttctgggtg
cagtttgcatgcgccacagccatgggactcggaacatctgtcggcggctggaaaatcatc
aaaaccgtcggcggaaaaatcatgaagatccgtcccgtcaacggtgtctctgcagatttg
acgggagccctcatcatctttggtgcgacgatcgtccatttgcctgtcagcacgacacac
gtcatttcttcatccattttaggcgtgggcgcttcccaccgggtgaaaggcgttaactgg
ggcaccgcaaagcggatgttgatcacatgggtcattacccttcccatttcggcaactatc
ggtgcatttgcctatttcatacttgatttattcttttaa

DBGET integrated database retrieval system