KEGG   Bacillus paralicheniformis: BaLi_c22250Help
Entry
BaLi_c22250       CDS       T02694                                 

Gene name
proJ
Definition
(GenBank) glutamate 5-kinase ProJ
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00330  Arginine and proline metabolism
blh00332  Carbapenem biosynthesis
blh01100  Metabolic pathways
blh01130  Biosynthesis of antibiotics
blh01230  Biosynthesis of amino acids
Module
blh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BaLi_c22250 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BaLi_c22250 (proJ)
Enzymes [BR:blh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BaLi_c22250 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA ADIP
Motif
Other DBs
NCBI-ProteinID: AGN36579
Position
complement(2197176..2198297)
Genome map
AA seq 373 aa AA seqDB search
MTSNQQRVVVKVGSSSLTSLHGEISSKKLEKLVEQIVRLKDEGHEVLLVSSGAVAAGYRK
LGFINRPDTLPEKQASASVGQGLLIEAYSKLFLSHGYIASQILITKSDFSDEKRYNNVRN
TMNVLLKRGIIPIINENDTVTVNRLKFGDNDTLSAKVAGLIDANLLTILSDIDGLYDANP
RKTPDAALVREVNEITPEIEASAGDAGSEVGTGGMKSKLDAFKITMASGIKGFLGRADTS
GLLQEAISGTARGTYFIPNDDSHTLNHKKQWIAFNSGPEGDIIVHNESKEFIIDRKKSLY
PSSIYEINGRFSNGSVVRILDQEGEEIGLGVVNFSSSQLRKWKKDTNQETAASSQAVVDR
EAFVCHLELSVPL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacctctaatcaacagagggtagttgtcaaagtgggaagcagttctttaacaagtctt
cacggcgaaatcagcagcaaaaagctcgaaaagctcgttgagcagatcgtccgcctcaaa
gatgaagggcacgaagtcctcctcgtttcatctggcgctgtggcggccggataccggaaa
cttggcttcattaacaggccggatacattgcctgaaaaacaagcatccgcatctgtcggc
cagggcttactaatcgaagcgtattccaagctctttttatcccatggctatatcgcttca
caaatattaatcacaaaaagcgatttttcagatgaaaaacggtacaacaatgtgagaaat
acgatgaatgttctgttgaaacgcggcattattccgatcatcaacgaaaatgacacagtt
accgtcaaccggctcaaattcggagacaatgatacgctttctgctaaagtggcgggtctg
atcgacgctaacctgctgaccatcctctctgatatagacggcctttatgacgcgaatccg
cgaaaaacgccggacgccgcactcgtccgggaagtaaatgaaatcacgccggagatagaa
gcttcagcaggggatgccggaagcgaagtcggaacaggcggcatgaagtcgaaactggac
gcttttaaaattacaatggcttcaggcatcaaaggatttttagggcgtgcagacacctcc
ggtctgttgcaagaagcaatcagcgggactgcgaggggaacgtattttattccgaatgac
gattcacacacactcaaccataaaaagcaatggatagcatttaactctggacctgaagga
gacatcatcgtccacaacgaaagcaaagagtttattatcgaccgtaaaaaaagcctgtat
ccttctagtatttacgaaattaacggccgtttcagcaacggttccgtcgttcgaatcctt
gatcaggaaggagaggaaatcggcctcggcgtcgtcaacttttcctcatcccagcttcgt
aaatggaagaaggatacgaatcaggaaacagccgcttcctcacaggctgtcgttgacaga
gaagcgtttgtctgtcatttagagctatccgttccgctttaa

DBGET integrated database retrieval system