KEGG   Bacillus paralicheniformis: BaLi_c39840Help
Entry
BaLi_c39840       CDS       T02694                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase MmgA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00071  Fatty acid degradation
blh00072  Synthesis and degradation of ketone bodies
blh00280  Valine, leucine and isoleucine degradation
blh00310  Lysine degradation
blh00362  Benzoate degradation
blh00380  Tryptophan metabolism
blh00620  Pyruvate metabolism
blh00630  Glyoxylate and dicarboxylate metabolism
blh00640  Propanoate metabolism
blh00650  Butanoate metabolism
blh00900  Terpenoid backbone biosynthesis
blh01100  Metabolic pathways
blh01110  Biosynthesis of secondary metabolites
blh01120  Microbial metabolism in diverse environments
blh01130  Biosynthesis of antibiotics
blh01200  Carbon metabolism
blh01212  Fatty acid metabolism
blh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BaLi_c39840 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BaLi_c39840 (mmgA)
   00640 Propanoate metabolism
    BaLi_c39840 (mmgA)
   00650 Butanoate metabolism
    BaLi_c39840 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BaLi_c39840 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BaLi_c39840 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BaLi_c39840 (mmgA)
   00310 Lysine degradation
    BaLi_c39840 (mmgA)
   00380 Tryptophan metabolism
    BaLi_c39840 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BaLi_c39840 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BaLi_c39840 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BaLi_c39840 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blh04147]
    BaLi_c39840 (mmgA)
Enzymes [BR:blh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BaLi_c39840 (mmgA)
Exosome [BR:blh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BaLi_c39840 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGN38296
Position
complement(3972996..3974174)
Genome map
AA seq 392 aa AA seqDB search
MARSVIAGGARTPFGKLGGALQSKTAAELGGIAVKEALKRSGVHPEDVDEVIMGSVLQGG
QGQLPSRQAARFAGLPWDVRTETINKVCASGLRSVTMADQIIRAGDAEVIAAGGMESMSN
APYLLQKARWGLRMGDGAVKDLMITDGLTCSFTGVHMGSYGNAAAKELEIAREEQDRWAL
RSHMRAVQAADSGALGEEIVPVRIPQKRGGELTVDQDEAPRRDTSLERLSQLAPVFDHDG
TITAGNAPGVNDGACSLIVMNEDRAKELNVNVSAVIKAHTSIAVEAKDFPKTPGLVIREL
LNKTGAELSDIKLFEINEAFAAVALASGKIAGLDMEKVNVNGGAIALGHPIGASGARIIL
TLMYELKRRGGGTGIAAICSGGGQGDAVMIKV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagatcggttattgcaggcggcgcgcgcacgccttttggaaaactcggaggcgcg
cttcagtcaaagacggcagcggagctcggcggaatcgccgtaaaagaagcattaaaacgt
tccggtgtacatcctgaggatgtcgatgaagtcattatgggttccgttcttcaaggcgga
caggggcagctgccgtcgagacaggccgcgcgttttgcgggactcccgtgggacgtcaga
acggaaacgattaataaagtgtgcgcttcaggtttaagaagcgtcacaatggcggatcag
atcatccgggccggtgatgcggaggtcattgcagcaggaggtatggaatcgatgtcaaac
gccccttatttgcttcaaaaagcgagatgggggctgagaatgggagacggagcggttaaa
gatttgatgatcacagacgggctgacatgctcatttacgggcgttcatatgggctcctac
ggaaatgccgctgcgaaagagttggagattgccagggaagagcaggatcggtgggcgctc
aggagccacatgcgagccgtacaggctgcggattcaggcgcgctcggagaagagatcgtc
ccggttcgtataccgcagaagcgaggcggcgaattaacggtcgatcaagatgaagctccg
cggcgcgacacgtcattggaaaggctgtcacaacttgctccggtttttgaccatgacggg
acaattactgcgggaaacgcgccgggtgtaaatgacggggcatgttcgcttatcgtgatg
aatgaagacagggcaaaggaactcaatgtgaatgtgtccgccgtcattaaagcgcacaca
tccattgcagtcgaagccaaagatttcccgaaaaccccagggcttgtcatcagagaactg
cttaacaaaaccggagctgagctttctgatatcaaactgtttgaaatcaatgaagctttc
gccgcggtagctttggcaagcggaaagatcgcgggccttgacatggagaaggtcaatgtc
aacggcggcgccattgcgcttggccatccgatcggagcgagcggggcaagaatcattttg
acgcttatgtacgaattaaaacggcgcggcggcggtacaggtattgctgccatttgcagc
ggcggcggtcagggagacgccgtgatgatcaaggtataa

DBGET integrated database retrieval system